Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAndrogen-induced gene 1 protein (AIG1)
LigandBDBM195603
Substrate/Competitorn/a
Meas. Tech.Gel-based ABPP Assay
IC50 1.7e+2± 3e+1 nM
Citation Parsons, WHKolar, MJKamat, SSCognetta, ABHulce, JJSaez, EKahn, BBSaghatelian, ACravatt, BF AIG1 and ADTRP are atypical integral membrane hydrolases that degrade bioactive FAHFAs. Nat Chem Biol12:367-72 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Androgen-induced gene 1 protein (AIG1)
Name:Androgen-induced gene 1 protein (AIG1)
Synonyms:n/a
Type:Protein
Mol. Mass.:28229.15
Organism:Homo sapiens (Human)
Description:n/a
Residue:245
Sequence:
MALVPCQVLRMAILLSYCSILCNYKAIEMPSHQTYGGSWKFLTFIDLVIQAVFFGICVLT
DLSSLLTRGSGNQEQERQLKKLISLRDWMLAVLAFPVGVFVVAVFWIIYAYDREMIYPKL
LDNFIPGWLNHGMHTTVLPFILIEMRTSHHQYPSRSSGLTAICTFSVGYILWVCWVHHVT
GMWVYPFLEHIGPGARIIFFGSTTILMNFLYLLGEVLNNYIWDTQKKPPSWQDMKIKFMY
LGPSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM195603
NameBDBM195603
Synonyms:KC01
TypeSmall organic molecule
Emp. Form.C22H39NO3
Mol. Mass.365.55
SMILESCCCCCCCCCCCCCC1OC(=O)\C1=C/CCCCC(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a