Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG-protein coupled receptor 10 (GPR10)
LigandBDBM195673
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
pH7.4±n/a
Temperature298.15±n/a K
Ki 2±n/a nM
Commentsextracted
Citation Takahashi, ASuzuki, MNakamura, YSakurai, Y Heterocyclic compounds for the treatment of stress-related conditions US Patent US9206173 Publication Date 12/8/2015
More Info.:Get all data from this article,  Assay Method
 
G-protein coupled receptor 10 (GPR10)
Name:G-protein coupled receptor 10 (GPR10)
Synonyms:GPR10 | Prolactin Releasing Peptide Receptor | Prolactin-releasing peptide receptor
Type:Protein
Mol. Mass.:41138.32
Organism:Homo sapiens (Human)
Description:P49683
Residue:370
Sequence:
MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLK
GLIVLLYSVVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAY
AFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAV
LAIWALSAVLALPAAVHTYHVELKPHDVRLCEEFWGSQERQRQLYAWGLLLVTYLLPLLV
ILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLLVVIVVVFAVCWLPLHVFNLL
RDLDPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLLVAWPRKIAPH
GQNMTVSVVI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM195673
NameBDBM195673
Synonyms:US9206173, 2435
TypeSmall organic molecule
Emp. Form.C28H23F4N5O2
Mol. Mass.537.5081
SMILESC[C@H](Nc1nc2CCN(Cc2c(=O)n1CCC#C)C(=O)c1ccc(cc1F)C#N)c1ccc(cc1)C(F)(F)F |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a