Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFocal adhesion kinase 1/vascular endothelial growth factor receptor 3
LigandBDBM202463
Substrate/Competitorn/a
Meas. Tech.VEGFR3 Biochemical Assay
pH7.4±n/a
IC50 3±n/a nM
Commentsextracted
Citation Foitzik, RCMorrow, BJHemley, CFLunniss, GECamerino, MAGaname, DStupple, PALessene, RKersten, WJHarvey, AJHolmes, IP VEGFR3 inhibitors US Patent US9238644 Publication Date 1/19/2016
More Info.:Get all data from this article,  Assay Method
 
Focal adhesion kinase 1/vascular endothelial growth factor receptor 3
Name:Focal adhesion kinase 1/vascular endothelial growth factor receptor 3
Synonyms:FLT-4 | FLT4 | Fms-like tyrosine kinase 4 | VEGFR-3 | Vascular endothelial growth factor receptor | Vascular endothelial growth factor receptor 3 | Vascular endothelial growth factor receptor 3 (VEGFR-3) | Vascular endothelial growth factor receptor 3 (VEGFR3)
Type:Protein
Mol. Mass.:152749.58
Organism:Homo sapiens (Human)
Description:P35916
Residue:1363
Sequence:
MQRGAALCLRLWLCLGLLDGLVSGYSMTPPTLNITEESHVIDTGDSLSISCRGQHPLEWA
WPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARI
EGTTAASSYVFVRDFEQPFINKPDTLLVNRKDAMWVPCLVSIPGLNVTLRSQSSVLWPDG
QEVVWDDRRGMLVSTPLLHDALYLQCETTWGDQDFLSNPFLVHITGNELYDIQLLPRKSL
ELLVGEKLVLNCTVWAEFNSGVTFDWDYPGKQAERGKWVPERRSQQTHTELSSILTIHNV
SQHDLGSYVCKANNGIQRFRESTEVIVHENPFISVEWLKGPILEATAGDELVKLPVKLAA
YPPPEFQWYKDGKALSGRHSPHALVLKEVTEASTGTYTLALWNSAAGLRRNISLELVVNV
PPQIHEKEASSPSIYSRHSRQALTCTAYGVPLPLSIQWHWRPWTPCKMFAQRSLRRRQQQ
DLMPQCRDWRAVTTQDAVNPIESLDTWTEFVEGKNKTVSKLVIQNANVSAMYKCVVSNKV
GQDERLIYFYVTTIPDGFTIESKPSEELLEGQPVLLSCQADSYKYEHLRWYRLNLSTLHD
AHGNPLLLDCKNVHLFATPLAASLEEVAPGARHATLSLSIPRVAPEHEGHYVCEVQDRRS
HDKHCHKKYLSVQALEAPRLTQNLTDLLVNVSDSLEMQCLVAGAHAPSIVWYKDERLLEE
KSGVDLADSNQKLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSEDKGSMEIVILV
GTGVIAVFFWVLLLLIFCNMRRPAHADIKTGYLSIIMDPGEVPLEEQCEYLSYDASQWEF
PRERLHLGRVLGYGAFGKVVEASAFGIHKGSSCDTVAVKMLKEGATASEHRALMSELKIL
IHIGNHLNVVNLLGACTKPQGPLMVIVEFCKYGNLSNFLRAKRDAFSPCAEKSPEQRGRF
RAMVELARLDRRRPGSSDRVLFARFSKTEGGARRASPDQEAEDLWLSPLTMEDLVCYSFQ
VARGMEFLASRKCIHRDLAARNILLSESDVVKICDFGLARDIYKDPDYVRKGSARLPLKW
MAPESIFDKVYTTQSDVWSFGVLLWEIFSLGASPYPGVQINEEFCQRLRDGTRMRAPELA
TPAIRRIMLNCWSGDPKARPAFSELVEILGDLLQGRGLQEEEEVCMAPRSSQSSEEGSFS
QVSTMALHIAQADAEDSPPSLQRHSLAARYYNWVSFPGCLARGAETRGSSRMKTFEEFPM
TPTTYKGSVDNQTDSGMVLASEEFEQIESRHRQESGFSCKGPGQNVAVTRAHPDSQGRRR
RPERGARGGQVFYNSEYGELSEPSEEDHCSPSARVTFFTDNSY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM202463
NameBDBM202463
Synonyms:US9238644, 65
TypeSmall organic molecule
Emp. Form.C21H21F3N6O
Mol. Mass.430.4262
SMILESCn1cc(Nc2ncc(c(CCc3ccccc3C3(CC3)C(N)=O)n2)C(F)(F)F)cn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a