Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOrexin receptor type 1
LigandBDBM203016
Substrate/Competitorn/a
Meas. Tech.In Vitro Assay: Intracellular Calcium Measurements
Temperature310.15±n/a K
IC50 231±n/a nM
Commentsextracted
Citation Aissaoui, HBoss, CBrotschi, CHeidmann, BSifferlen, TWilliams, JT Lactam derivatives useful as orexin receptor antagonists US Patent US9242970 Publication Date 1/26/2016
More Info.:Get all data from this article,  Assay Method
 
Orexin receptor type 1
Name:Orexin receptor type 1
Synonyms:Hypocretin receptor type 1 | Orexin receptor type 1 (OR 1) | Orexin receptor type 1 (OR-1) | Orexin receptor type 1 (OX1) | Orexin receptor type 1 (OX1R) | Orexin receptor type 1 (OxR1) | Ox1r
Type:Protein
Mol. Mass.:47554.50
Organism:Homo sapiens (Human)
Description:O43613
Residue:425
Sequence:
MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVA
LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCK
VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQA
AVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFR
KLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKML
MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNF
LSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSV
TTVLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM203016
NameBDBM203016
Synonyms:US9242970, 167
TypeSmall organic molecule
Emp. Form.C21H21ClF3NO4
Mol. Mass.443.844
SMILESCOc1cc(Cl)cc(OC)c1C1CCCC(=O)N1Cc1ccc(OC(F)(F)F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a