Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcyl-protein thioesterase 2 (APT2 L78I/A85S)
LigandBDBM207991
Substrate/Competitorn/a
Meas. Tech.Steady-State Kinetic Assays
Ki 6200±310 nM
Citation Won, SJDavda, DLabby, KJHwang, SYPricer, RMajmudar, JDArmacost, KARodriguez, LARodriguez, CLChong, FSTorossian, KAPalakurthi, JHur, ESMeagher, JLBrooks, CLStuckey, JAMartin, BR Molecular Mechanism for Isoform-Selective Inhibition of Acyl Protein Thioesterases 1 and 2 (APT1 and APT2). ACS Chem Biol11:3374-3382 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acyl-protein thioesterase 2 (APT2 L78I/A85S)
Name:Acyl-protein thioesterase 2 (APT2 L78I/A85S)
Synonyms:n/a
Type:Protein
Mol. Mass.:24756.23
Organism:Homo sapiens (Human)
Description:Human APT2 with L78I/A85S mutations
Residue:231
Sequence:
MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAP
RIPVTLNMKMVMPSWFDIMGLSPDSPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGG
FSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVP
VRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM207991
NameBDBM207991
Synonyms:ML348
TypeSmall organic molecule
Emp. Form.C18H17ClF3N3O3
Mol. Mass.415.794
SMILESFC(F)(F)c1ccc(Cl)c(NC(=O)CN2CCN(CC2)C(=O)c2ccco2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a