Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcyl-protein thioesterase 1
LigandBDBM207992
Substrate/Competitorn/a
Meas. Tech.Steady-State Kinetic Assays
Ki>10000±0.0 nM
Citation Won, SJDavda, DLabby, KJHwang, SYPricer, RMajmudar, JDArmacost, KARodriguez, LARodriguez, CLChong, FSTorossian, KAPalakurthi, JHur, ESMeagher, JLBrooks, CLStuckey, JAMartin, BR Molecular Mechanism for Isoform-Selective Inhibition of Acyl Protein Thioesterases 1 and 2 (APT1 and APT2). ACS Chem Biol11:3374-3382 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acyl-protein thioesterase 1
Name:Acyl-protein thioesterase 1
Synonyms:APT-1 | Acyl-protein thioesterase 1 (APT1 WT) | LPL-I | LysoPLA I | Lysophospholipase 1 | Lysophospholipase I | hAPT1
Type:Protein
Mol. Mass.:24670.33
Organism:Homo sapiens (Human)
Description:O75608
Residue:230
Sequence:
MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRP
VTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQ
GGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLM
FGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM207992
n/a
NameBDBM207992
Synonyms:ML349
TypeSmall organic molecule
Emp. Form.C23H22N2O4S2
Mol. Mass.454.562
SMILESCOc1ccc(cc1)N1CCN(CC1)C(=O)c1cc2CS(=O)(=O)c3ccccc3-c2s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: