Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEphrin type-A receptor 2 (EPHA2)
LigandBDBM50322535
Substrate/Competitorn/a
Meas. Tech.Kinobeads Competition Assay
Kd 6.9±0.0 nM
Citation Heinzlmeir, SKudlinzki, DSreeramulu, SKlaeger, SGande, SLLinhard, VWilhelm, MQiao, HHelm, DRuprecht, BSaxena, KMédard, GSchwalbe, HKuster, B Chemical Proteomics and Structural Biology Define EPHA2 Inhibition by Clinical Kinase Drugs. ACS Chem Biol11:3400-3411 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ephrin type-A receptor 2 (EPHA2)
Name:Ephrin type-A receptor 2 (EPHA2)
Synonyms:n/a
Type:Protein
Mol. Mass.:34367.96
Organism:Homo sapiens (Human)
Description:EPHA2 truncation (596-900 aa); 519U
Residue:305
Sequence:
DPNQAVLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTEK
QRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQ
LVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTS
GGKIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFR
LPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRL
PSTSG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50322535
n/a
NameBDBM50322535
Synonyms:3-(imidazo[1,2-b]pyridazin-3-ylethynyl)-4-methyl-N-{4-[(4-methylpiperazin-1-yl)methyl]-3-(trifluoromethyl)phenyl}benzamide | 3-[2-(Imidazo[1,2-b]pyridazin-3-yl)ethynyl]-4-methyl-N-{4-[(4-methylpiperazin-1-yl)methyl]-3-(trifluoromethyl)phenyl}benzamide | CHEMBL1171837 | PONATINIB | US9255107, AP24534
TypeSmall organic molecule
Emp. Form.C29H27F3N6O
Mol. Mass.532.5595
SMILESCN1CCN(Cc2ccc(NC(=O)c3ccc(C)c(c3)C#Cc3cnc4cccnn34)cc2C(F)(F)F)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: