Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEphrin type-A receptor 2 (EPHA2)
LigandBDBM209862
Substrate/Competitorn/a
Meas. Tech.Kinobeads Competition Assay
Kd 265±0.0 nM
Citation Heinzlmeir, SKudlinzki, DSreeramulu, SKlaeger, SGande, SLLinhard, VWilhelm, MQiao, HHelm, DRuprecht, BSaxena, KMédard, GSchwalbe, HKuster, B Chemical Proteomics and Structural Biology Define EPHA2 Inhibition by Clinical Kinase Drugs. ACS Chem Biol11:3400-3411 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ephrin type-A receptor 2 (EPHA2)
Name:Ephrin type-A receptor 2 (EPHA2)
Synonyms:n/a
Type:Protein
Mol. Mass.:34367.96
Organism:Homo sapiens (Human)
Description:EPHA2 truncation (596-900 aa); 519U
Residue:305
Sequence:
DPNQAVLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTEK
QRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQ
LVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTS
GGKIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFR
LPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRL
PSTSG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM209862
NameBDBM209862
Synonyms:4-(3-chloro-2-fluorophenoxy)-1-[[6-(1,3-thiazol-2-ylamino)pyridin-2-yl]methyl]cyclohexane-1-carboxylic acid | MK-5108
TypeSmall organic molecule
Emp. Form.C22H21ClFN3O3S
Mol. Mass.461.937
SMILESOC(=O)C1(Cc2cccc(Nc3nccs3)n2)CCC(CC1)Oc1cccc(Cl)c1F |(6.1,3.85,;7.64,3.85,;8.41,5.18,;8.41,2.52,;9.18,3.85,;10.72,3.85,;11.49,5.18,;13.03,5.18,;13.8,3.85,;13.03,2.52,;13.8,1.18,;15.35,1.18,;16.25,-.06,;17.71,.41,;17.71,1.95,;16.25,2.43,;11.49,2.52,;7.08,1.75,;7.08,.21,;8.41,-.56,;9.75,.21,;9.75,1.75,;8.41,-2.1,;7.08,-2.87,;7.08,-4.41,;5.75,-5.18,;4.41,-4.41,;4.41,-2.87,;3.08,-2.1,;5.75,-2.1,;5.75,-.56,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a