Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEpoxide hydratase
LigandBDBM50327837
Substrate/Competitorn/a
Meas. Tech.Fluorescent Based Assay
pH7±n/a
IC50 1100±n/a nM
Commentsextracted
Citation Hammock, BDRose, TMorisseau, CLee, KS Acyl piperidine inhibitors of soluble epoxide hydrolase US Patent US9296693 Publication Date 3/29/2016
More Info.:Get all data from this article,  Assay Method
 
Epoxide hydratase
Name:Epoxide hydratase
Synonyms:Soluble epoxide hydrolase (sEH) | epoxide hydrolase 2, cytoplasmic
Type:Enzyme
Mol. Mass.:62613.07
Organism:Homo sapiens (Human)
Description:P34913
Residue:555
Sequence:
MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITL
SQWIPLMEENCRKCSETAKVCLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTA
ILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEV
VFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHG
YVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESS
APPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNT
PFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMH
KVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSL
GRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIK
WLDSDARNPPVVSKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50327837
NameBDBM50327837
Synonyms:1-(2-Chlorophenyl)-3-(1-propionylpiperidin-4-yl)urea | CHEMBL1258556 | US9296693, 31
TypeSmall organic molecule
Emp. Form.C15H20ClN3O2
Mol. Mass.309.791
SMILESCCC(=O)N1CCC(CC1)NC(=O)Nc1ccccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a