Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetκ opioid receptor (KOR Y320A)
LigandBDBM214799
Substrate/Competitorn/a
Meas. Tech.Homologous Competition Assay
Ki 4.2e+3±2.4e+3 nM
Citation Vardy, EMosier, PDFrankowski, KJWu, HKatritch, VWestkaemper, RBAubé, JStevens, RCRoth, BL Chemotype-selective modes of action of ¿-opioid receptor agonists. J Biol Chem288:34470-83 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
κ opioid receptor (KOR Y320A)
Name:κ opioid receptor (KOR Y320A)
Synonyms:n/a
Type:Protein
Mol. Mass.:42556.66
Organism:Homo sapiens (Human)
Description:Human KOR with Y320A mutation
Residue:380
Sequence:
MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG
STSHSTAALSSYYFCIALGATNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRV
RNTVQDPAYLRDIDGMNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM214799
n/a
NameBDBM214799
Synonyms:1xx
TypeSmall organic molecule
Emp. Form.C24H22ClF3N2O2
Mol. Mass.462.892
SMILESFC(F)(F)c1cc(NC(=O)[C@H]2CC=C[C@H]3CCN(Cc4ccccc4)C(=O)[C@@H]23)ccc1Cl |r,c:12|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: