Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMDM2 and p53
LigandBDBM215165
Substrate/Competitorn/a
Meas. Tech.Homogenous Time-Resolved Fluorescence Assay (HTRF1 Assay)
pH7.4±n/a
Temperature298.15±n/a K
IC50 390±n/a nM
Commentsextracted
Citation Bartberger, MDGonzalez Buenrostro, ABeck, HPChen, XConnors, RVDeignan, JDuquette, JAEksterowicz, JFisher, BFox, BMFu, JFu, ZGonzalez Lopez De Turiso, FGribble, MWGustin, DJHeath, JAHuang, XJiao, XJohnson, MGKayser, FKopecky, DJLai, SLi, YLi, ZLiu, JLow, JDLucas, BSMa, ZMcGee, LRMcIntosh, JMcMinn, DLMedina, JCMihalic, JTOlson, SHRew, YRoveto, PMSun, DWang, XWang, YYan, XYu, MZhu, J Piperidinone derivatives as MDM2 inhibitors for the treatment of cancer US Patent US9296736 Publication Date 3/29/2016
More Info.:Get all data from this article,  Assay Method
 
MDM2 and p53
Name:MDM2 and p53
Synonyms:n/a
Type:Enzyme
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:E3 ubiquitin-protein ligase Mdm2
Synonyms:E3 ubiquitin-protein ligase Mdm2 (aa 1-188)
Type:n/a
Mol. Mass.:21319.18
Organism:Homo sapiens (Human)
Description:n/a
Residue:188
Sequence:
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGT
SVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQ
RKRHKSDS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Tumor suppressor p53
Synonyms:n/a
Type:Enzyme
Mol. Mass.:8975.74
Organism:Homo sapiens (Human)
Description:Residues 1-83
Residue:83
Sequence:
MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP
DEAPRMPEAAPPVAPAPAAPTPA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM215165
NameBDBM215165
Synonyms:US9296736, 116 | US9593129, Example 116
TypeSmall organic molecule
Emp. Form.C27H29Cl2NO3
Mol. Mass.486.43
SMILESC[C@@]1(CC(O)=O)C[C@@H](C(N(C(C2CC2)C2CC2)C1=O)c1ccc(Cl)cc1)c1cccc(Cl)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a