Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProto-oncogene tyrosine-protein kinase Src
LigandBDBM6098
Substrate/CompetitorBiotinylated peptide substrate
Meas. Tech.Homogeneous Time-resolved Fluorescence (HTRF) Assay
IC50 87±n/a nM
Citation Boschelli, DHWu, BBarrios Sosa, ACDurutlic, HChen, JJWang, YGolas, JMLucas, JBoschelli, F Synthesis and Src kinase inhibitory activity of 2-phenyl- and 2-thienyl-7-phenylaminothieno[3,2-b]pyridine-6-carbonitriles. J Med Chem48:3891-902 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Proto-oncogene tyrosine-protein kinase Src
Name:Proto-oncogene tyrosine-protein kinase Src
Synonyms:Proto-oncogene c-Src | Proto-oncogene tyrosine-protein kinase Src (c-Src) | SRC | Tyrosine-protein kinase Src (SRC) | V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) | c-Src | p60-Src | pp60c-src
Type:Protein
Mol. Mass.:59838.60
Organism:Homo sapiens (Human)
Description:P12931
Residue:536
Sequence:
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM6098
NameBDBM6098
Synonyms:4-[(2,4-Dichloro-5-methoxyphenyl)amino]-6-methoxy-7-[(1-methyl-2-piperidinyl)methoxy]-3-quinolinecarbonitrile | 4-[(2,4-dichloro-5-methoxyphenyl)amino]-6-methoxy-7-[(1-methylpiperidin-2-yl)methoxy]quinoline-3-carbonitrile | 4-phenylamino-3-quinolinecarbonitrile 9
TypeSmall organic molecule
Emp. Form.C25H26Cl2N4O3
Mol. Mass.501.405
SMILESCOc1cc(Nc2c(cnc3cc(OCC4CCCCN4C)c(OC)cc23)C#N)c(Cl)cc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
Biotinylated peptide substrate
Name:Biotinylated peptide substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:2353.23
Organism:n/a
Description:Biotinylated peptide corresponding to residues 6 to 20 of Cdk1. 100 uM ATP as co-substrate.
Residue:21
Sequence:
Biotin-KVEKIGEGTYGVVYK-COOH