Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphoenolpyruvate carboxykinase, cytosolic [GTP] [H477R]
LigandBDBM223201
Substrate/Competitorn/a
Meas. Tech.PEPCK Inhibition Assay
Ki 3.7e+4± 8e+3 nM
Citation Cui, DSBroom, AMcleod, MJMeiering, EMHolyoak, T Asymmetric Anchoring Is Required for Efficient O-Loop Opening and Closing in Cytosolic Phosphoenolpyruvate Carboxykinase. Biochemistry56:2106-2115 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phosphoenolpyruvate carboxykinase, cytosolic [GTP] [H477R]
Name:Phosphoenolpyruvate carboxykinase, cytosolic [GTP] [H477R]
Synonyms:Phosphoenolpyruvate carboxykinase (PEPCK H477R)
Type:Enzyme
Mol. Mass.:69434.03
Organism:Rattus norvegicus (Rat)
Description:Rat cytosolic PEPCK H477R mutant
Residue:622
Sequence:
MPPQLHNGLDFSAKVIQGSLDSLPQEVRKFVEGNAQLCQPEYIHICDGSEEEYGRLLAHM
QEEGVIRKLKKYDNCWLALTDPRDVARIESKTVIITQEQRDTVPIPKSGQSQLGRWMSEE
DFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLAKIGIELTDSPYVVASMRIMTRMGTSV
LEALGDGEFIKCLHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGNSL
LGKKCFALRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTL
PGWKVECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNV
AETSDGGVYWEGIDEPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAW
ESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKVIMRDPF
AMRPFFGYNFGKYLAHWLSMAHRPAAKLPKIFHVNWFRKDKNGKFLWPGFGENSRVLEWM
FGRIEGEDSAKLTPIGYVPKEDALNLKGLGDVNVEELFGISKEFWEKEVEEIDKYLEDQV
NADLPYEIERELRALKQRISQM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM223201
NameBDBM223201
Synonyms:β-Sulfopyruvate
TypeSmall organic molecule
Emp. Form.C3H4O6S
Mol. Mass.168.125
SMILESOC(=O)C(=O)CS(O)(=O)=O
Structure
n/a