Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 5 (MC5R)
LigandBDBM232058
Substrate/Competitorn/a
Meas. Tech.Radioligand Binding Assay
pH7.4±n/a
Temperature310.15±n/a K
IC50<10000±n/a nM
Commentsextracted
Citation Blaskovich, MACassidy, PJ Methods of modulating the activity of the MC5 receptor and treatment of conditions related to this receptor US Patent US9340517 Publication Date 5/17/2016
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 5 (MC5R)
Name:Melanocortin receptor (M4 and M5)
Synonyms:MC-2 | MC5-R | MC5R | Melanocortin MC5 | Melanocortin receptor 5
Type:Enzyme
Mol. Mass.:36612.92
Organism:Homo sapiens (Human)
Description:P33032
Residue:325
Sequence:
MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGA
IVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILY
SESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQGAVTV
TMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ
EMRKTFKEIICCRGFRIACSFPRRD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM232058
n/a
NameBDBM232058
Synonyms:US9340517, 446
TypeSmall Organic Molecule
Emp. Form.C33H41ClN4O2
Mol. Mass.561.157
SMILESC[C@@H](CN1CC[C@H](CNC(=O)c2ccc3ccccc3c2)N[C@H](CCN2CCCCC2)C1=O)c1ccc(Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: