Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVoltage-dependent calcium channel gamma-2 subunit
LigandBDBM292059
Substrate/Competitorn/a
Meas. Tech.Biological Assays Calcium Flux Assay
pH7.4±n/a
IC50 0.631±n/a nM
Commentsextracted
Citation Ameriks, MKLaforteza, BNSavall, BMWade, WSMeyer, STGyuris, M 3-aryl-2H-pyrazolo[4,3-b]pyridine compounds and their use as AMPA receptor modulators US Patent US10100045 Publication Date 10/16/2018  Article
More Info.:Get all data from this article,  Assay Method
 
Voltage-dependent calcium channel gamma-2 subunit
Name:Voltage-dependent calcium channel gamma-2 subunit
Synonyms:CACNG2 | Neuronal voltage-gated calcium channel gamma-2 subunit | TARP gamma-2 | Transmembrane AMPAR regulatory protein gamma-2
Type:Enzyme Catalytic Domain
Mol. Mass.:35977.54
Organism:Homo sapiens (Human)
Description:n/a
Residue:323
Sequence:
MGLFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSVSENETSKKNEEVMTH
SGLWRTCCLEGNFKGLCKQIDHFPEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGL
CIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSF
YFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSS
SRSTEPSHSRDASPVGIKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVH
NCIQKENKDSLHSNTANRRTTPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM292059
NameBDBM292059
Synonyms:2-(Difluoromethyl)-3-(7-methyl-1H-indazol-5-yl)-5-(trifluoromethyl)-2H- | US10100045, Example 30
TypeSmall organic molecule
Emp. Form.C16H10F5N5
Mol. Mass.367.2761
SMILESCc1cc(cc2cn[nH]c12)-c1n(nc2ccc(nc12)C(F)(F)F)C(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a