Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosinase
LigandBDBM50031467
Substrate/Competitorn/a
Meas. Tech.In Vitro Tyrosinase Inhibition Assay
pH6.8±n/a
Temperature298.15±n/a K
IC50 1.667e+4± 5.1e+2 nM
Commentsextracted
Citation Khan, SBHassan Khan, MTJang, ESAkhtar, KSeo, JHan, H Tyrosinase inhibitory effect of benzoic acid derivatives and their structure-activity relationships. J Enzyme Inhib Med Chem25:812-7 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosinase
Name:Tyrosinase
Synonyms:Polyphenol oxidase
Type:Enzyme
Mol. Mass.:63902.83
Organism:Agaricus bisporus (White button mushroom)
Description:Q00024
Residue:568
Sequence:
MSHLLVSPLGGGVQPRLEINNFVKNDRQFSLYVQALDRMYATPQNETASYFQVAGVHGYP
LIPFDDAVGPTEFSPFDQWTGYCTHGSTLFPTWHRPYVLILEQILSGHAQQIADTYTVNK
SEWKKAATEFRHPYWDWASNSVPPPEVISLPKVTITTPNGQKTSVANPLMRYTFNSVNDG
GFYGPYNQWDTTLRQPDSTGVNAKDNVNRLKSVLKNAQASLTRATYDMFNRVTTWPHFSS
HTPASGGSTSNSIEAIHDNIHVLVGGNGHMSDPSVAPFDPIFFLHHANVDRLIALWSAIR
YDVWTSPGDAQFGTYTLRYKQSVDESTDLAPWWKTQNEYWKSNELRSTESLGYTYPEFVG
LDMYNKDAVNKTISRKVAQLYGPQRGGQRSLVEDLSNSHARRSQRPAKRSRLGQLLKGLF
SDWSAQIKFNRHEVGQSFSVCLFLGNVPEDPREWLVSPNLVGARHAFVRSVKTDHVAEEI
GFIPINQWIAEHTGLPSFAVDLVKPLLAQGLQWRVLLADGTPAELDSLEVTILEVPSELT
DDEPNPRSRPPRYHKDITHGKRGGCREA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50031467
NameBDBM50031467
Synonyms:5-HYDROXY-2-(HYDROXYMETHYL)-4H-PYRAN-4-ONE | 5-Hydroxy-2-hydroxymethyl-pyran-4-one | CHEMBL287556 | Kojic Acid | US9422261, Kojic acid | US9682910, kojic acid
TypeSmall organic molecule
Emp. Form.C6H6O4
Mol. Mass.142.1094
SMILESOCc1cc(=O)c(O)co1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a