Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetN-acylethanolamine-hydrolyzing acid amidase (NAAA)
LigandBDBM50439665
Substrate/Competitorn/a
Meas. Tech.Enzymatic Assay
pH7.4±n/a
IC50 18±n/a nM
Commentsextracted
Citation Piomelli, DBandiera, TMor, MTarzia, GBertozzi, FPonzano, S Disubstituted beta-lactones as inhibitors of N-acylethanolamine acid amidase (NAAA) US Patent US9353075 Publication Date 5/31/2016
More Info.:Get all data from this article,  Assay Method
 
N-acylethanolamine-hydrolyzing acid amidase (NAAA)
Name:N-acylethanolamine-hydrolyzing acid amidase (NAAA)
Synonyms:ASAH-like protein | Asahl | N-acylethanolamine acid amidase (NAAA) | N-acylethanolamine-hydrolyzing acid amidase | N-acylethanolamine-hydrolyzing acid amidase subunit alpha | N-acylethanolamine-hydrolyzing acid amidase subunit beta | N-acylsphingosine amidohydrolase-like | Naaa
Type:Enzyme
Mol. Mass.:40306.53
Organism:Rattus norvegicus (Rat)
Description:Q5KTC7
Residue:362
Sequence:
MGTPAIRAACHGAHLALALLLLLSLSDPWLWATAPGTPPLFNVSLDAAPELRWLPMLQHY
DPDFVRAAVAQVIGDRVPQWILEMIGEIVQKVESFLPQPFTSEIRGICDYLNLSLAEGVL
VNLAYEASAFCTSIVAQDSQGRIYHGRNLDYPFGNALRKLTADVQFVKNGQIVFTATTFV
GYVGLWTGQSPHKFTISGDERDKGWWWENMIAALSLGHSPISWLIRKTLTESEDFEAAVY
TLAKTPLIADVYYIVGGTSPQEGVVITRDRGGPADIWPLDPLNGAWFRVETNYDHWEPVP
KRDDRRTPAIKALNATGQAHLSLETLFQVLSVFPVYNNYTIYTTVMSAAEPDKYMTMIRN
PS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50439665
NameBDBM50439665
Synonyms:CHEMBL2419819 | US9353075, 38
TypeSmall organic molecule
Emp. Form.C16H21NO4
Mol. Mass.291.3422
SMILESC[C@H]1OC(=O)[C@@H]1NC(=O)OCCCCCc1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a