Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetN-acylethanolamine-hydrolyzing acid amidase
LigandBDBM50032463
Substrate/Competitorn/a
Meas. Tech.Fluorogenic Assay
pH4.5±n/a
IC50 8±n/a nM
Commentsextracted
Citation Piomelli, DBandiera, TMor, MTarzia, GBertozzi, FPonzano, S Disubstituted beta-lactones as inhibitors of N-acylethanolamine acid amidase (NAAA) US Patent US9353075 Publication Date 5/31/2016
More Info.:Get all data from this article,  Assay Method
 
N-acylethanolamine-hydrolyzing acid amidase
Name:N-acylethanolamine-hydrolyzing acid amidase
Synonyms:ASAH-like protein | ASAHL | Acid ceramidase-like protein | N-acylsphingosine amidohydrolase-like | N-acylsphingosine-amidohydrolase | NAAA | PLT
Type:Enzyme
Mol. Mass.:40073.12
Organism:Homo sapiens (Human)
Description:Q02083
Residue:359
Sequence:
MRTADREARPGLPSLLLLLLAGAGLSAASPPAAPRFNVSLDSVPELRWLPVLRHYDLDLV
RAAMAQVIGDRVPKWVHVLIGKVVLELERFLPQPFTGEIRGMCDFMNLSLADCLLVNLAY
ESSVFCTSIVAQDSRGHIYHGRNLDYPFGNVLRKLTVDVQFLKNGQIAFTGTTFIGYVGL
WTGQSPHKFTVSGDERDKGWWWENAIAALFRRHIPVSWLIRATLSESENFEAAVGKLAKT
PLIADVYYIVGGTSPREGVVITRNRDGPADIWPLDPLNGAWFRVETNYDHWKPAPKEDDR
RTSAIKALNATGQANLSLEALFQILSVVPVYNNFTIYTTVMSAGSPDKYMTRIRNPSRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50032463
NameBDBM50032463
Synonyms:CHEMBL3353547 | US9353075, 19
TypeSmall organic molecule
Emp. Form.C15H25NO4
Mol. Mass.283.3633
SMILESC[C@@H]1OC(=O)[C@@H]1NC(=O)OCCCCC1CCCCC1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a