Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetUrease
LigandBDBM50099857
Substrate/Competitorn/a
Meas. Tech.Urease Inhibition Assay
pH7.4±n/a
Temperature277.15±n/a K
IC50 4.247e+4± 1.9e+2 nM
Commentsextracted
Citation Cui, YMDong, XWChen, WWang, WJLi, YGZhu, HL Synthesis, inhibitory activity and molecular docking studies of two Cu(II) complexes against Helicobacter pylori urease. J Enzyme Inhib Med Chem27:528-32 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Urease
Name:Urease
Synonyms:n/a
Type:Enzyme
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:Urease subunit alpha
Synonyms:n/a
Type:Enzyme
Mol. Mass.:26573.32
Organism:Helicobacter pylori ATCC43504
Description:I0ZGT1
Residue:238
Sequence:
MKLTPKELDKLMLHYAGELARKRKEKGIKLNYVEAVALISAHIMEEARAGKKTAAELMQE
GRTLLKPDDVMDGVASMIHEVGIEAMFPDGTKLVTVHTPIEANGKLVPGELFLKNEDITI
NEGKKAVSVKVKNVGDRPVQIGSHFHFFEVNRCLDFDREKTFGKRLDIASGTAVRFEPGE
EKSVELIDIGGNRRIFGFNALVDRQADNESKKIALHRAKERGFHGAKSDDNYVKTIKE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Urease subunit beta
Synonyms:n/a
Type:Enzyme
Mol. Mass.:29567.71
Organism:Helicobacter pylori ATCC43504
Description:I0ZGT0
Residue:281
Sequence:
MKKISRKEYVSMYGPTTGDKVRLGDTDLIAEVEHDYTIYGEELKFGGGKTLREGMSQSNN
PSKEELDLIITNALIVDYTGIYKADIGIKDGKIAGIGKGGNKDMQDGVKNNLSVGPATEA
LAGEGLIVTAGGIDTHIHFISPQQIPTAFASGVTTMIGGGTGPADGTNATTITPGRRNLK
WMLRAAEEYSMNLGFLAKGNTSNDASLADQIEAGAIGFKIHEDWGTTPSAINHALDVADK
YDVQVAIHTDTLNEAGCVEDTMAAIAGRTMHTFHTEGAGGG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50099857
NameBDBM50099857
Synonyms:ACETOHYDROXAMIC ACID (AHA) | AHA | Acethydroxamsaeure | Acethydroxamsaure | Acetic acid, oxime | Acetylhydroxamic acid | Cetohyroxamic acid | Lithostat | Methylhydroxamic acid | N-Acetyl hydroxyacetamide | N-Acetylhydroxylamine | N-Hydroxyacetamide | acetohydroxamic acid
TypeSmall organic molecule
Emp. Form.C2H5NO2
Mol. Mass.75.0666
SMILESCC(=O)NO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a