Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 11B2 (CYP11B2)
LigandBDBM238149
Substrate/Competitorn/a
Meas. Tech.Cellular Inhibition Assay
Temperature310.15±n/a K
IC50 0.1±n/a nM
Commentsextracted
Citation Hartmann, RHille, UZimmer, CVock, CAHu, Q Selective CYP11B1 inhibitors for the treatment of cortisol dependent diseases US Patent US9394290 Publication Date 7/19/2016
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 11B2 (CYP11B2)
Name:Cytochrome P450 11B2 (CYP11B2)
Synonyms:Aldosterone Synthase (CYP11B2) | Aldosterone synthase | Aldosterone-synthesizing enzyme | CYPXIB2 | Cytochrome P450 11B2 | Cytochrome P450 11B2, mitochondrial | P-450Aldo | P-450C18 | Steroid 18-hydroxylase
Type:Protein
Mol. Mass.:57582.15
Organism:Homo sapiens (Human)
Description:P19099
Residue:503
Sequence:
MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQG
YEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYR
QHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNA
RGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFM
PRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELS
LEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATT
ELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRP
ERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQED
IKMVYSFILRPGTSPLLTFRAIN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM238149
NameBDBM238149
Synonyms:US9394290, ETO (etomidate)
TypeSmall organic molecule
Emp. Form.C14H16N2O2
Mol. Mass.244.289
SMILESCCOC(=O)c1cncn1C(C)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a