Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProto-oncogene tyrosine-protein kinase Src
LigandBDBM6462
Substrate/Competitorcdc2 substrate peptide
Meas. Tech.Kinase inhibition Assay
pH7.5±n/a
Temperature303.15±n/a K
IC50 1.8±n/a nM
Citation Berger, DMDutia, MBirnberg, GPowell, DBoschelli, DHWang, YDRavi, MYaczko, DGolas, JLucas, JBoschelli, F 4-Anilino-7,8-dialkoxybenzo[g]quinoline-3-carbonitriles as potent Src kinase inhibitors. J Med Chem48:5909-20 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Proto-oncogene tyrosine-protein kinase Src
Name:Calmodulin/Proto-oncogene tyrosine-protein kinase Src
Synonyms:Proto-oncogene c-Src | Proto-oncogene tyrosine-protein kinase Src (c-Src) | SRC | Tyrosine-protein kinase Src (SRC) | V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) | c-Src | p60-Src | pp60c-src
Type:Protein
Mol. Mass.:59838.60
Organism:Homo sapiens (Human)
Description:P12931
Residue:536
Sequence:
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM6462
NameBDBM6462
Synonyms:4-Anilino-7,8-dialkoxybenzo[g]quinoline-3-carbonitrile 16c | 4-[(2,4-dichloro-5-methoxyphenyl)amino]-8-methoxy-7-[2-(morpholin-4-yl)ethoxy]benzo[g]quinoline-3-carbonitrile
TypeSmall organic molecule
Emp. Form.C28H26Cl2N4O4
Mol. Mass.553.436
SMILESCOc1cc(Nc2c(cnc3cc4cc(OC)c(OCCN5CCOCC5)cc4cc23)C#N)c(Cl)cc1Cl
Structure
cdc2 substrate peptide
Name:cdc2 substrate peptide
Synonyms:n/a
Type:Peptide
Mol. Mass.:358.43
Organism:n/a
Description:100 uM ATP as co-substrate
Residue:3
Sequence:
n/a