Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetParathyroid hormone 1 receptor (PTH1R)
LigandBDBM64564
Substrate/Competitorn/a
Meas. Tech.cAMP Assay
pH7.4±n/a
EC50 1900±n/a nM
Commentsextracted
Citation Nishimura, YEsaki, TTamura, T Hydantoin derivative US Patent US9428505 Publication Date 8/30/2016
More Info.:Get all data from this article,  Assay Method
 
Parathyroid hormone 1 receptor (PTH1R)
Name:Parathyroid hormone 1 receptor (PTH1R)
Synonyms:Parathyroid hormone/parathyroid hormone-related peptide receptor
Type:Enzyme
Mol. Mass.:66273.93
Organism:Rattus norvegicus (Rat)
Description:P25961
Residue:591
Sequence:
MGAARIAPSLALLLCCPVLSSAYALVDADDVFTKEEQIFLLHRAQAQCDKLLKEVLHTAA
NIMESDKGWTPASTSGKPRKEKASGKFYPESKENKDVPTGSRRRGRPCLPEWDNIVCWPL
GAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWEVVPGHNRTWANYSECLKFMTNETRE
REVFDRLGMIYTVGYSMSLASLTVAVLILAYFRRLHCTRNYIHMHMFLSFMLRAASIFVK
DAVLYSGFTLDEAERLTEEELHIIAQVPPPPAAAAVGYAGCRVAVTFFLYFLATNYYWIL
VEGLYLHSLIFMAFFSEKKYLWGFTIFGWGLPAVFVAVWVGVRATLANTGCWDLSSGHKK
WIIQVPILASVVLNFILFINIIRVLATKLRETNAGRCDTRQQYRKLLRSTLVLVPLFGVH
YTVFMALPYTEVSGTLWQIQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIRKSWSRWTLA
LDFKRKARSGSSSYSYGPMVSHTSVTNVGPRAGLSLPLSPRLPPATTNGHSQLPGHAKPG
APATETETLPVTMAVPKDDGFLNGSCSGLDEEASGSARPPPLLQEEWETVM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM64564
NameBDBM64564
Synonyms:US9428505, Compound 8
Typen/a
Emp. Form.C31H34F3N5O6S
Mol. Mass.661.692
SMILESCc1cc(cc(C)c1CCS(=O)(=O)N1CCC2(CC1)N=C(NC2=O)c1ccc(OC(F)(F)F)cc1)N1C(=O)NC(=O)C11CCCC1 |c:21|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a