Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNuclear receptor ROR-gamma
LigandBDBM253089
Substrate/Competitorn/a
Meas. Tech.Scintillation Proximity Assay (SPA)
Temperature298.15±n/a K
IC50 281±n/a nM
Commentsextracted
Citation Duan, JDhar, TGJiang, BLu, ZXiao, H Pyrrolidinyl sulfone RORγ modulators US Patent US9458171 Publication Date 10/4/2016
More Info.:Get all data from this article,  Assay Method
 
Nuclear receptor ROR-gamma
Name:Nuclear receptor ROR-gamma
Synonyms:ROR-gamma (A262-S507)
Type:Enzyme Catalytic Domain
Mol. Mass.:28605.37
Organism:Homo sapiens (Human)
Description:aa 262-507
Residue:246
Sequence:
APYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCA
HHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGK
YGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQ
LQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPL
YKELFS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM253089
NameBDBM253089
Synonyms:US9458171, 49
TypeSmall organic molecule
Emp. Form.C22H20F7NO5S
Mol. Mass.543.452
SMILESCOCC(=O)N1CCC(C1)(c1ccc(cc1)C(O)(C(F)(F)F)C(F)(F)F)S(=O)(=O)c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a