Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetChymase
LigandBDBM256082
Substrate/Competitorn/a
Meas. Tech.Enzymatic Chymase Assay
pH7.5±n/a
IC50 31±n/a nM
Commentsextracted
Citation Fürstner, CAckerstaff, JStraub, AMeier, HTinel, HZimmermann, KTersteegen, AZubov, DKast, RSchamberger, JSchäfer, MBörngen, K Bicyclically substituted uracils and the use thereof US Patent US9481672 Publication Date 11/1/2016
More Info.:Get all data from this article,  Assay Method
 
Chymase
Name:Chymase
Synonyms:n/a
Type:Enzyme
Mol. Mass.:27507.42
Organism:Mesocricetus auratus (Golden hamster)
Description:A0A1U7QTH6
Residue:247
Sequence:
MLLPALRLLLFLLGSSAEAGKIIGGTECRPHARPYMAYLEIVTPENHLSACSGFLIRRNF
VMTAAHCAGRSITVLLGAHNKKVKEDTWQKLEVEKQFPHPKYDDHLVLNDIMLLKLKEKA
NLTLGVGTLPISAKSNSIPPGRVCRAVGWGRTNVNEPPSDTLQEVKMRILDPQACKHFED
FHQEPQLCVGNPKKIRNVYKGDSGGPLLCAGIAQGIASYVLRNAKPPSVFTRISHYRPWI
NKILREN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM256082
NameBDBM256082
Synonyms:US9481672, 264
TypeSmall organic molecule
Emp. Form.C21H14ClF3N4O5
Mol. Mass.494.808
SMILESCc1cc2[nH]c(=O)[nH]c2cc1-n1cc(C(O)=O)c(=O)n(Cc2cccc(c2Cl)C(F)(F)F)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a