Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-secretase 2
LigandBDBM259080
Substrate/Competitorn/a
Meas. Tech.Time-Resolved Endpoint Proteolysis Assay
pH5±n/a
Temperature303.15±n/a K
Ki 550±n/a nM
Commentsextracted
Citation Wu, WBurnett, DAStamford, AWCumming, JNBennett, CEGilbert, EJScott, JDYu, YPeng, X 5-substituted iminothiazines and their mono- and dioxides as BACE inhibitors, compositions, and their use US Patent US9499502 Publication Date 11/22/2016
More Info.:Get all data from this article,  Assay Method
 
Beta-secretase 2
Name:Beta-secretase (BACE)
Synonyms:ASP1 | Asp 1 | Aspartic-like protease 56 kDa | Aspartyl protease 1 | Beta secretase 2 | Beta-secretase 2 (BACE-2) | Beta-secretase 2 precursor | Beta-site APP-cleaving enzyme 2 | Down region aspartic protease | Memapsin-1 | Membrane-associated aspartic protease 1 | beta-Secretase (BACE-2)
Type:Protein
Mol. Mass.:56171.20
Organism:Homo sapiens (Human)
Description:Q9Y5Z0
Residue:518
Sequence:
MGALARALLLPLLAQWLLRAAPELAPAPFTLPLRVAAATNRVVAPTPGPGTPAERHADGL
ALALEPALASPAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAG
TPHSYIDTYFDTERSSTYRSKGFDVTVKYTQGSWTGFVGEDLVTIPKGFNTSFLVNIATI
FESENFFLPGIKWNGILGLAYATLAKPSSSLETFFDSLVTQANIPNVFSMQMCGAGLPVA
GSGTNGGSLVLGGIEPSLYKGDIWYTPIKEEWYYQIEILKLEIGGQSLNLDCREYNADKA
IVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSETPWSYFPKISI
YLRDENSSRSFRITILPQLYIQPMMGAGLNYECYRFGISPSTNALVIGATVMEGFYVIFD
RAQKRVGFAASPCAEIAGAAVSEISGPFSTEDVASNCVPAQSLSEPILWIVSYALMSVCG
AILLVLIVLLLLPFRCQRRPRDPEVVNDESSLVRHRWK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM259080
NameBDBM259080
Synonyms:US9499502, 22b
TypeSmall organic molecule
Emp. Form.C17H20ClN5O3S2
Mol. Mass.441.955
SMILESC[C@]1(CS(=O)(=O)C(C)(C)C(=N)N1)c1sc(cc1Cl)C(=O)NCc1ncccn1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a