Target
Epoxide hydrolase
Ligand
BDBM25737
Substrate
n/a
Meas. Tech.
Inhibition Assay
IC50
21.0±n/a nM
Citation
 Guedes, AGHammock, BDMorisseau, C Treatment of inflammatory disorders in non-human mammals US Patent  US10383835 Publication Date 8/20/2019
Target
Name:
Epoxide hydrolase
Synonyms:
EPHX1
Type:
Enzyme
Mol. Mass.:
48577.06
Organism:
Equus caballus (Horse)
Description:
A0A5F5PR84
Residue:
418
Sequence:
MPQYQTWEEFSRAAEKLYLADPMKDLHQRIDKARLTPPLEDSRFHYGFNSNYLKQIVSYWRNEFDWKKQVEILNRYPHFKTKIEGLDIHFIHVKPPQLPSGRTPKPLLMVHGWPGSFYEFYKIIPFLTDPKSHGLGDEHVFEVICPCIPGYGFSEASSKKGFNTVATARIFYKLMLRLGFQEFYVQGGDWGALICTNIAQLVPSHVKGLHLNMAFVLRSFYTLTLPLGRHFAGLFGYTHKDVELMYPFKEKIFYSLMRESGYMHIQATKPDTVGCALNDSPVGLAAYILEKFSTWTKSEFRDLEDGGLERKFSLDDLLTNIMLYWTTGSITSSQRFYKENLGQGYMAHKHERMKVYVPTGFAAFPCELLHAPENWVKFKYPKLISYSYMPRGGHFAAFEEPQLLAQDIRKFVGLLERQ
  
Inhibitor
Name:
BDBM25737
Synonyms:
12-[(adamantan-1-ylcarbamoyl)amino]dodecanoic acid | CHEMBL215387 | US10383835, Compound 700 | Urea-based compound, 18
Type:
Small organic molecule
Emp. Form.:
C23H40N2O3
Mol. Mass.:
392.5753
SMILES:
OC(=O)CCCCCCCCCCCNC(=O)NC12CC3CC(CC(C3)C1)C2 |TLB:25:20:27:24.23.26,25:24:20.21.19:27,THB:23:22:19:24.25.26,23:24:19:22.21.27|
Structure:
Search PDB for entries with ligand similarity: