Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEpoxide hydrolase 1
LigandBDBM50327846
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
IC50 190±n/a nM
Citation Guedes, AGHammock, BDMorisseau, C Treatment of inflammatory disorders in non-human mammals US Patent US10383835 Publication Date 8/20/2019
More Info.:Get all data from this article,  Assay Method
 
Epoxide hydrolase 1
Name:Epoxide hydrolase 1
Synonyms:EPHX1
Type:n/a
Mol. Mass.:55532.32
Organism:Felis catus (Cat) (Felis silvestris catus)
Description:A0A2I2V3F9
Residue:483
Sequence:
MLTSPSFSLGVTATMVPTVPSTCPRLLKGKGIMWLEILLASVLAFVVYWFVSRDKEETLP
LEDGWWGPGARPTAPEDESIRPFKVETSDEEIKDLHRRIDGTRLTPPLEDSRFHYGFNSN
YLKKILSYWRNEFDWRKQVEMLNRYPHFKTRIEGLDIHFVHVKPPQLPPGRTPKPLLMVH
GWPGSFYEFYKIIPLLTDPANHGLSEEHVFEVICPSIPGYAFSEAASKKGLNSVATARIF
YKLMLRLGFREFYIQGGDWGALICTHMAQMVPSHVKGLHLNMAFILNGRILTLFLVRHCP
RLFGFTQRDMELMLPFKEKIFYKPLRESGYMHIQSTKPDTVGCALNDSPAGLAAYILEKF
STWTDSEFQELEDGGLERKFSLDDLLTNVMLYWTTGTITSSQRFYKENRGQLFKQDRVKV
SVPTGLAAFPCELMHIPERWVKGKYPRLVSYSYMPRGGHFAALEEPELLARDIRKFVGLL
ELP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50327846
NameBDBM50327846
Synonyms:1-(1-(Cyclopropanecarbonyl)piperidin-4-yl)-3-(4-(trifluoromethoxy)phenyl)urea | CHEMBL1257405 | US10383835, Compound 2214 | US9296693, 52
TypeSmall organic molecule
Emp. Form.C17H20F3N3O3
Mol. Mass.371.3542
SMILESFC(F)(F)Oc1ccc(NC(=O)NC2CCN(CC2)C(=O)C2CC2)cc1
Structure
n/a