Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-Dependent Protein Kinase (PKA)
LigandBDBM6866
Substrate/CompetitorPKA Peptide Substrate
Meas. Tech.Kinase Inhibition Assay
IC50>100000±n/a nM
Citation Lin, RConnolly, PJHuang, SWetter, SKLu, YMurray, WVEmanuel, SLGruninger, RHFuentes-Pesquera, ARRugg, CAMiddleton, SAJolliffe, LK 1-Acyl-1H-[1,2,4]triazole-3,5-diamine analogues as novel and potent anticancer cyclin-dependent kinase inhibitors: synthesis and evaluation of biological activities. J Med Chem48:4208-11 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
cAMP-Dependent Protein Kinase (PKA)
Name:cAMP-dependent protein kinase A
Synonyms:PKA C-alpha | PKC | Protein Kinase C | Protein Kinase C, bovine brain | cAMP-dependent Protein Kinase, bovine heart | cAMP-dependent protein kinase A | cAMP-dependent protein kinase alpha-catalytic subunit | cAMP-dependent protein kinase, alpha-catalytic subunit
Type:Enzyme Complex
Mol. Mass.:40627.77
Organism:Bos taurus (bovine)
Description:The PKA holoenzyme purified from bovine heart, exists as an inactive tetrameric complex, which consists of a regulatory dimer associated with two catalytic subunits. It requires cAMP to activate the enzymatic reaction.
Residue:351
Sequence:
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM6866
NameBDBM6866
Synonyms:1-Acyl-1H-[1,2,4]triazole-3,5-diamine Analogue 3b | 4-({5-amino-1-[(2,6-difluorophenyl)carbonyl]-1H-1,2,4-triazol-3-yl}amino)benzene-1-sulfonamide | 4-[[5-Amino-1-(2,6-difluorobenzoyl)-1H-1,2,4-triazol-3-yl]amino]-benzenesulfonamide | CHEMBL191003 | JNJ-7706621 | cid_5330790
TypeSmall organic molecule
Emp. Form.C15H12F2N6O3S
Mol. Mass.394.356
SMILESNc1nc(Nc2ccc(cc2)S(N)(=O)=O)nn1C(=O)c1c(F)cccc1F
Structure
PKA Peptide Substrate
Name:PKA Peptide Substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:2018.28
Organism:n/a
Description:n/a
Residue:18
Sequence:
biotin-GRTGRRNSI-amide