Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-Dependent Kinase 6 (CDK6)
LigandBDBM7458
Substrate/CompetitorHistone H1
Meas. Tech.Kinase Inhibition Assay
pH7±n/a
Temperature303.15±n/a K
IC50 1700±n/a nM
Citation Lu, HChang, DJBaratte, BMeijer, LSchulze-Gahmen, U Crystal structure of a human cyclin-dependent kinase 6 complex with a flavonol inhibitor, fisetin. J Med Chem48:737-43 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Cyclin-Dependent Kinase 6 (CDK6)
Name:Cyclin-Dependent Kinase 6 (CDK6)
Synonyms:CDK6/Vcyclin
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:Cyclin-dependent kinase 6
Synonyms:CDK6 | CDKN6 | Cell division protein kinase 6 | Cyclin-dependent kinase 6 (CDK 6) | Serine/threonine-protein kinase PLSTIRE
Type:Enzyme Subunit
Mol. Mass.:36937.42
Organism:Homo sapiens (Human)
Description:Q00534
Residue:326
Sequence:
MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYF
QDLERCKENLDSHLPPSQNTSELNTA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Vcyclin
Synonyms:viral cyclin
Type:Enzyme Subunit
Mol. Mass.:28634.62
Organism:Saimiriine herpesvirus 2
Description:Sf9 insect cells were infected with recombinant baculovirus containing the His-tagged Vcyclin gene. The protein was purified over a Talon column (BD Biosciences Clontech, Palo Alto, CA) followed by a Source Q ion-exchange column (Amersham Bioscience, Piscataway, NJ). The N-terminal His tag was removed from Vcyclin using recombinant tobacco etch virus protease.
Residue:254
Sequence:
MADSPNRLNRAKIDSTTMKDPRVLNNLKLRELLLPKFTSLWEIQTEVTVDNRTILLTWMH
LLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGSKIRTVKPMTVSKLT
YLSCDCFTNLELINQEKDILEALKWDTEAVLATDFLIPLCNALKIPEDLWPQLYEAASTT
ICKALIQPNIALLSPGLICAGGLLTTIETDNTNCRPWTCYLEDLSSILNFSTNTVRTVKD
QVSEAFSLYDLEIL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM7458
NameBDBM7458
Synonyms:5,7-dihydroxy-2-(4-hydroxyphenyl)-4H-chromen-4-one | 5,7-dihydroxy-2-(4-hydroxyphenyl)-chromen-4-one | Apigenin | Apigenin (2) | Apigenin (3) | Apigenin (7) | Apigenin, 13 | CHEMBL28 | Naringenin, 18 | cid_5280443
TypeSmall organic molecule
Emp. Form.C15H10O5
Mol. Mass.270.2369
SMILESOc1ccc(cc1)-c1cc(=O)c2c(O)cc(O)cc2o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
Histone H1
Name:Histone H1
Synonyms:n/a
Type:Other Protein Type
Mol. Mass.:358.43
Organism:Bos taurus (bovine)
Description:n/a
Residue:3
Sequence:
n/a