Compile Data Set for Download or QSAR
Report error Found 1 Enz. Inhib. hit(s) for PDB: 1OKY
Target3-phosphoinositide-dependent protein kinase 1(Human)
Center for Lymphoid Malignancies

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 130909BDBM130909(US8822500, Stauro- sporine | US9920060, Staurospor...)
Affinity DataIC50: 5.60nMAssay Description:Inhibition of human PDK1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition and...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/13/2025
Entry Details
PubMedPDB3D3D Structure (crystal)