BDBM378885 US10266537, Compound 93

SMILES Cc1ccc(NC(=O)c2ccc(C)c(c2)C(F)(F)F)cc1C#Cc1nn([C@H]2CC[C@H](O)CC2)c2ncnc(N)c12

InChI Key InChIKey=YHVHYWYQEFELOW-HZCBDIJESA-N

Data  85 IC50

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 1 hit for monomerid = 378885   

TargetEphrin type-A receptor 7(Homo sapiens (Human))
Sichuan University

Curated by ChEMBL
LigandPNGBDBM378885(US10266537, Compound 93)
Affinity DataIC50:  143nMAssay Description:Inhibition of human recombinant EPHA7 (613 to 909 residues) using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC incubated for 40 mins in presence of [gamma...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed