Affinity DataKi: 0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 0.700nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 0.900nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: <1nM ΔG°: <-50.9kJ/molepH: 8.0 T: 2°CAssay Description:The enzyme assay was performed in a round-bottom 96-well plate. The enzyme was pre-incubated in the assay buffer in the presence of NADPH and inhibit...More data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Inhibition of mouse 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Inhibition of mouse 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 1.30nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1.40nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 1.40nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 1.60nM ΔG°: -52.2kJ/molepH: 4.5 T: 2°CAssay Description:Enzyme activities were assayed by monitoring the hydrolysis of substrate in the presence or absence of inhibitor compounds. The hydrolysis was record...More data for this Ligand-Target Pair
Affinity DataKi: 1.60nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 1.70nM ΔG°: -49.6kJ/molepH: 8.0 T: 2°CAssay Description:The enzyme assay was performed in a round-bottom 96-well plate. The enzyme was pre-incubated in the assay buffer in the presence of NADPH and inhibit...More data for this Ligand-Target Pair
Affinity DataKi: 1.75nM ΔG°: -49.5kJ/molepH: 7.4 T: 2°CAssay Description:The inhibitors reported in this study bind to CHK1 according to a general mechanism illustrated in Scheme 1 where E, S, and I stand for enzyme, subst...More data for this Ligand-Target Pair
Affinity DataKi: 1.90nM ΔG°: -49.3kJ/molepH: 8.0 T: 2°CAssay Description:The enzyme assay was performed in a round-bottom 96-well plate. The enzyme was pre-incubated in the assay buffer in the presence of NADPH and inhibit...More data for this Ligand-Target Pair
Affinity DataKi: 2nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 2nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 2.40nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 2.40nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 2.5nM ΔG°: -51.1kJ/molepH: 4.5 T: 2°CAssay Description:Enzyme activities were assayed by monitoring the hydrolysis of substrate in the presence or absence of inhibitor compounds. The hydrolysis was record...More data for this Ligand-Target Pair
Affinity DataKi: 2.5nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 3.10nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 3.5nMAssay Description:Inhibition of mouse 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 3.60nMAssay Description:Inhibition of mouse 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 3.60nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 4nM ΔG°: -47.5kJ/molepH: 8.0 T: 2°CAssay Description:The enzyme assay was performed in a round-bottom 96-well plate. The enzyme was pre-incubated in the assay buffer in the presence of NADPH and inhibit...More data for this Ligand-Target Pair
Affinity DataKi: 4.80nM ΔG°: -47.0kJ/molepH: 8.0 T: 2°CAssay Description:The enzyme assay was performed in a round-bottom 96-well plate. The enzyme was pre-incubated in the assay buffer in the presence of NADPH and inhibit...More data for this Ligand-Target Pair
Affinity DataKi: 5.14nM ΔG°: -46.5kJ/molepH: 8.0 T: 2°CAssay Description:Surface plasmon resonance (SPR) biosensor binding studies were conducted using a Biacore 3000 instrument (GE Healtchare).More data for this Ligand-Target Pair
Affinity DataKi: 5.40nMAssay Description:Inhibition of mouse 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 5.80nM ΔG°: -46.5kJ/molepH: 8.0 T: 2°CAssay Description:The enzyme assay was performed in a round-bottom 96-well plate. The enzyme was pre-incubated in the assay buffer in the presence of NADPH and inhibit...More data for this Ligand-Target Pair
Affinity DataKi: 5.90nM ΔG°: -48.9kJ/molepH: 4.5 T: 2°CAssay Description:Enzyme activities were assayed by monitoring the hydrolysis of substrate in the presence or absence of inhibitor compounds. The hydrolysis was record...More data for this Ligand-Target Pair
Affinity DataKi: 6.30nMAssay Description:Inhibition of mouse 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 6.60nM ΔG°: -46.2kJ/molepH: 8.0 T: 2°CAssay Description:The enzyme assay was performed in a round-bottom 96-well plate. The enzyme was pre-incubated in the assay buffer in the presence of NADPH and inhibit...More data for this Ligand-Target Pair
Affinity DataKi: 8nM ΔG°: -48.1kJ/molepH: 4.5 T: 2°CAssay Description:Enzyme activities were assayed by monitoring the hydrolysis of substrate in the presence or absence of inhibitor compounds. The hydrolysis was record...More data for this Ligand-Target Pair
Affinity DataKi: 9.40nM ΔG°: -47.7kJ/molepH: 4.5 T: 2°CAssay Description:Enzyme activities were assayed by monitoring the hydrolysis of substrate in the presence or absence of inhibitor compounds. The hydrolysis was record...More data for this Ligand-Target Pair
Affinity DataKi: 9.40nMAssay Description:Inhibition of mouse 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 9.80nM ΔG°: -45.3kJ/molepH: 8.0 T: 2°CAssay Description:The enzyme assay was performed in a round-bottom 96-well plate. The enzyme was pre-incubated in the assay buffer in the presence of NADPH and inhibit...More data for this Ligand-Target Pair
Affinity DataKi: 10nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
Affinity DataKi: 15nMAssay Description:Inhibition of human 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 16nMAssay Description:Inhibition of mouse 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 17nMAssay Description:Inhibition of mouse 11-beta-HSD1More data for this Ligand-Target Pair
Affinity DataKi: 20nM ΔG°: -43.5kJ/molepH: 8.0 T: 2°CAssay Description:The enzyme assay was performed in a round-bottom 96-well plate. The enzyme was pre-incubated in the assay buffer in the presence of NADPH and inhibit...More data for this Ligand-Target Pair