Affinity DataKi: 0.0470nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.0640nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.0900nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.100nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
Affinity DataKi: 0.110nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
Affinity DataKi: 0.110nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.110nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.120nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.130nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.190nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.190nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
Affinity DataKi: 0.196nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
Affinity DataKi: 0.200nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.200nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
Affinity DataKi: 0.200nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.200nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.200nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
Affinity DataKi: 0.210nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
Affinity DataKi: 0.240nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.270nMAssay Description:The respective human coronavirus Mpro in assay buffer (20 mM Tris-HCl, pH 7.3, 100 mM NaCl, 1 mM EDTA, 5 mM TCEP) and 0.1% BSA was added to assay-rea...More data for this Ligand-Target Pair
Affinity DataKi: 0.300nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.300nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.330nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.360nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.360nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.370nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.450nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.480nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.480nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
Affinity DataKi: 0.520nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
Affinity DataKi: 0.560nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 0.610nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.670nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.700nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 0.710nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.800nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.800nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.860nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
Affinity DataKi: 0.880nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
Affinity DataKi: 0.880nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.900nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 0.900nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 0.920nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
Affinity DataKi: 1nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1.10nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 1.10nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Affinity DataKi: 1.20nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
Affinity DataKi: 1.20nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair