Compile Data Set for Download or QSAR
maximum 50k data
Found 2109 with Last Name = 'ferre' and Initial = 'r'
LigandPNGBDBM370133(US10233188, Example 22 | US10800783, Example 22 | ...)
Affinity DataKi:  0.0470nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM467013((-)-6-(2,2-difluoroethyl)-8-[(1R*,2R*)-2-hydroxy-2...)
Affinity DataKi:  0.0640nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370147(US10233188, Example 36 | US10800783, Example 36 | ...)
Affinity DataKi:  0.0900nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM50609170(CHEMBL5266837)
Affinity DataKi:  0.100nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
In DepthDetails PubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM4779(CHEMBL31965 | CHEMBL545315 | CI-1033 | Canertinib ...)
Affinity DataKi:  0.110nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM467013((-)-6-(2,2-difluoroethyl)-8-[(1R*,2R*)-2-hydroxy-2...)
Affinity DataKi:  0.110nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370121(6-(difluoromethyl)-8-[(1R,2R)-2-hydroxy-2-methylcy...)
Affinity DataKi:  0.110nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
In DepthDetails PubMed
LigandPNGBDBM370205(US10233188, Example 92 | US10800783, Example 92 | ...)
Affinity DataKi:  0.120nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370121(6-(difluoromethyl)-8-[(1R,2R)-2-hydroxy-2-methylcy...)
Affinity DataKi:  0.130nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
In DepthDetails PubMed
LigandPNGBDBM467013((-)-6-(2,2-difluoroethyl)-8-[(1R*,2R*)-2-hydroxy-2...)
Affinity DataKi:  0.190nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370256(BDBM467151 | US10233188, Example 143)
Affinity DataKi:  0.190nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
In DepthDetails PubMed
LigandPNGBDBM370257(BDBM467152 | US10233188, Example 144)
Affinity DataKi:  0.196nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
In DepthDetails PubMed
LigandPNGBDBM6309(6-Acetyl-8-cyclopentyl-5-methyl-2-(5-piperazin-1-y...)
Affinity DataKi:  0.200nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
In DepthDetails PubMed
LigandPNGBDBM50609166(CHEMBL5280928)
Affinity DataKi:  0.200nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
In DepthDetails PubMed
LigandPNGBDBM370120(6-chloro-8-[(1R,2R)-2-hydroxy-2-methylcyclopentyl]...)
Affinity DataKi:  0.200nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370113(8-[(1R,2R)-2-hydroxy-2-methylcyclopentyl]-2-{[1-(m...)
Affinity DataKi:  0.200nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM50609166(CHEMBL5280928)
Affinity DataKi:  0.200nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
In DepthDetails PubMed
LigandPNGBDBM50609171(CHEMBL5288078)
Affinity DataKi:  0.210nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
In DepthDetails PubMed
LigandPNGBDBM370205(US10233188, Example 92 | US10800783, Example 92 | ...)
Affinity DataKi:  0.240nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetReplicase polyprotein 1ab(2019-nCoV)
Pfizer

LigandPNGBDBM420298(CVD-0006356 | PF-00835231 | PF-0835231 | US1152494...)
Affinity DataKi:  0.270nMAssay Description:The respective human coronavirus Mpro in assay buffer (20 mM Tris-HCl, pH 7.3, 100 mM NaCl, 1 mM EDTA, 5 mM TCEP) and 0.1% BSA was added to assay-rea...More data for this Ligand-Target Pair
Ligand InfoPurchasePDB
In DepthDetails PDB3D3D Structure (crystal)
LigandPNGBDBM370248((8-cyclopentyl-2-{[1-(methylsulfonyl)piperidin-4-y...)
Affinity DataKi:  0.300nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370140(US10233188, Example 29 | US10800783, Example 29 | ...)
Affinity DataKi:  0.300nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370133(US10233188, Example 22 | US10800783, Example 22 | ...)
Affinity DataKi:  0.330nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370140(US10233188, Example 29 | US10800783, Example 29 | ...)
Affinity DataKi:  0.360nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370130(US10233188, Example 19 | US10800783, Example 19 | ...)
Affinity DataKi:  0.360nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370120(6-chloro-8-[(1R,2R)-2-hydroxy-2-methylcyclopentyl]...)
Affinity DataKi:  0.370nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370120(6-chloro-8-[(1R,2R)-2-hydroxy-2-methylcyclopentyl]...)
Affinity DataKi:  0.450nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370248((8-cyclopentyl-2-{[1-(methylsulfonyl)piperidin-4-y...)
Affinity DataKi:  0.480nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370258(BDBM467153 | US10233188, Example 145)
Affinity DataKi:  0.480nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
In DepthDetails PubMed
LigandPNGBDBM370277(BDBM467172 | US10233188, Example 164)
Affinity DataKi:  0.520nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
In DepthDetails PubMed
LigandPNGBDBM370130(US10233188, Example 19 | US10800783, Example 19 | ...)
Affinity DataKi:  0.560nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361649(CHEMBL1938415)
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361648(CHEMBL1940246)
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM370133(US10233188, Example 22 | US10800783, Example 22 | ...)
Affinity DataKi:  0.610nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370112(8-cyclopentyl-2-{[1-(methylsulfonyl)piperidin-4-yl...)
Affinity DataKi:  0.670nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361642(CHEMBL1940251)
Affinity DataKi:  0.700nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM370112(8-cyclopentyl-2-{[1-(methylsulfonyl)piperidin-4-yl...)
Affinity DataKi:  0.710nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370147(US10233188, Example 36 | US10800783, Example 36 | ...)
Affinity DataKi:  0.800nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM6309(6-Acetyl-8-cyclopentyl-5-methyl-2-(5-piperazin-1-y...)
Affinity DataKi:  0.800nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
In DepthDetails PubMed
LigandPNGBDBM50609169(CHEMBL5275378)
Affinity DataKi:  0.860nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
In DepthDetails PubMed
LigandPNGBDBM50609168(CHEMBL5277190)
Affinity DataKi:  0.880nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
In DepthDetails PubMed
LigandPNGBDBM370112(8-cyclopentyl-2-{[1-(methylsulfonyl)piperidin-4-yl...)
Affinity DataKi:  0.880nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361641(CHEMBL1940247)
Affinity DataKi:  0.900nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM370248((8-cyclopentyl-2-{[1-(methylsulfonyl)piperidin-4-y...)
Affinity DataKi:  0.900nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370258(BDBM467153 | US10233188, Example 145)
Affinity DataKi:  0.920nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
In DepthDetails PubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361652(CHEMBL1940250)
Affinity DataKi:  1nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM370113(8-[(1R,2R)-2-hydroxy-2-methylcyclopentyl]-2-{[1-(m...)
Affinity DataKi:  1.10nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370205(US10233188, Example 92 | US10800783, Example 92 | ...)
Affinity DataKi:  1.10nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM50609168(CHEMBL5277190)
Affinity DataKi:  1.20nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
In DepthDetails PubMed
LigandPNGBDBM370130(US10233188, Example 19 | US10800783, Example 19 | ...)
Affinity DataKi:  1.20nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
Displayed 1 to 50 (of 2109 total ) | Next | Last >>
Jump to: