Compile Data Set for Download or QSAR
maximum 50k data
Found 1263 with Last Name = 'tran' and Initial = 'k'
TargetCoagulation factor X(Homo sapiens (Human))
Millennium Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM12751(1-(3-carbamimidoylphenyl)-3-methyl-N-[4-(2-sulfamo...)
Affinity DataKi:  0.0130nMAssay Description:Inhibitory activity of the compound against Coagulation factor Xa (serine protease) was determinedMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM370133(US10233188, Example 22 | US10800783, Example 22 | ...)
Affinity DataKi:  0.0470nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM467013((-)-6-(2,2-difluoroethyl)-8-[(1R*,2R*)-2-hydroxy-2...)
Affinity DataKi:  0.0640nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370147(US10233188, Example 36 | US10800783, Example 36 | ...)
Affinity DataKi:  0.0900nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM50609170(CHEMBL5266837)
Affinity DataKi:  0.100nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
In DepthDetails PubMed
LigandPNGBDBM370121(6-(difluoromethyl)-8-[(1R,2R)-2-hydroxy-2-methylcy...)
Affinity DataKi:  0.110nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM4779(CHEMBL31965 | CHEMBL545315 | CI-1033 | Canertinib ...)
Affinity DataKi:  0.110nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM467013((-)-6-(2,2-difluoroethyl)-8-[(1R*,2R*)-2-hydroxy-2...)
Affinity DataKi:  0.110nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370205(US10233188, Example 92 | US10800783, Example 92 | ...)
Affinity DataKi:  0.120nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370121(6-(difluoromethyl)-8-[(1R,2R)-2-hydroxy-2-methylcy...)
Affinity DataKi:  0.130nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetCannabinoid receptor 1(Rattus norvegicus (rat))
National And Kapodistrian University Of Athens

Curated by ChEMBL
LigandPNGBDBM50328671((6aR,9R,10aR)-3-(1-hexylcyclobutyl)-6,6-dimethyl-6...)
Affinity DataKi:  0.160nMAssay Description:Displacement of [3H]-CP-55,940 from CB1R in rat brain membranes measured by radioligand based competition binding assayMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetCoagulation factor X(Homo sapiens (Human))
Millennium Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50113598((Z)-3-(3-Carbamimidoyl-4-fluoro-phenyl)-2-fluoro-b...)
Affinity DataKi:  0.180nMAssay Description:Inhibitory activity of the compound against factor Xa,activity expressed as Ki nMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM370256(BDBM467151 | US10233188, Example 143)
Affinity DataKi:  0.190nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
In DepthDetails PubMed
LigandPNGBDBM467013((-)-6-(2,2-difluoroethyl)-8-[(1R*,2R*)-2-hydroxy-2...)
Affinity DataKi:  0.190nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370257(BDBM467152 | US10233188, Example 144)
Affinity DataKi:  0.196nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
In DepthDetails PubMed
LigandPNGBDBM370120(6-chloro-8-[(1R,2R)-2-hydroxy-2-methylcyclopentyl]...)
Affinity DataKi:  0.200nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370113(8-[(1R,2R)-2-hydroxy-2-methylcyclopentyl]-2-{[1-(m...)
Affinity DataKi:  0.200nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM50609166(CHEMBL5280928)
Affinity DataKi:  0.200nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
In DepthDetails PubMed
LigandPNGBDBM6309(6-Acetyl-8-cyclopentyl-5-methyl-2-(5-piperazin-1-y...)
Affinity DataKi:  0.200nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetApelin receptor(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM50583259(CHEMBL5094438)
Affinity DataKi:  0.200nMAssay Description:Displacement of [125I]-[Nle75,Tyr77][Pyr1]-Ape13 from YFP-tagged human APJ expressed in HEK293 cell membranes assessed as inhibition constant incubat...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
LigandPNGBDBM50609166(CHEMBL5280928)
Affinity DataKi:  0.200nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
In DepthDetails PubMed
LigandPNGBDBM50609171(CHEMBL5288078)
Affinity DataKi:  0.210nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
In DepthDetails PubMed
LigandPNGBDBM370205(US10233188, Example 92 | US10800783, Example 92 | ...)
Affinity DataKi:  0.240nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370248((8-cyclopentyl-2-{[1-(methylsulfonyl)piperidin-4-y...)
Affinity DataKi:  0.300nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370140(US10233188, Example 29 | US10800783, Example 29 | ...)
Affinity DataKi:  0.300nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370133(US10233188, Example 22 | US10800783, Example 22 | ...)
Affinity DataKi:  0.330nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370140(US10233188, Example 29 | US10800783, Example 29 | ...)
Affinity DataKi:  0.360nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370130(US10233188, Example 19 | US10800783, Example 19 | ...)
Affinity DataKi:  0.360nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370120(6-chloro-8-[(1R,2R)-2-hydroxy-2-methylcyclopentyl]...)
Affinity DataKi:  0.370nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetCannabinoid receptor 1(Rattus norvegicus (rat))
National And Kapodistrian University Of Athens

Curated by ChEMBL
LigandPNGBDBM50603275(CHEMBL5187249)
Affinity DataKi:  0.380nMAssay Description:Displacement of [3H]-CP-55,940 from CB1R in rat brain membranes measured by radioligand based competition binding assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370120(6-chloro-8-[(1R,2R)-2-hydroxy-2-methylcyclopentyl]...)
Affinity DataKi:  0.450nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetCannabinoid receptor 1(Rattus norvegicus (rat))
National And Kapodistrian University Of Athens

Curated by ChEMBL
LigandPNGBDBM50603264(CHEMBL5206676)
Affinity DataKi:  0.460nMAssay Description:Displacement of [3H]-CP-55,940 from CB1R in rat brain membranes measured by radioligand based competition binding assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370248((8-cyclopentyl-2-{[1-(methylsulfonyl)piperidin-4-y...)
Affinity DataKi:  0.480nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370258(BDBM467153 | US10233188, Example 145)
Affinity DataKi:  0.480nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
In DepthDetails PubMed
LigandPNGBDBM370277(BDBM467172 | US10233188, Example 164)
Affinity DataKi:  0.520nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand Info
In DepthDetails PubMed
TargetCannabinoid receptor 1(Rattus norvegicus (rat))
National And Kapodistrian University Of Athens

Curated by ChEMBL
LigandPNGBDBM50603277(CHEMBL5194920)
Affinity DataKi:  0.550nMAssay Description:Displacement of [3H]-CP-55,940 from CB1R in rat brain membranes measured by radioligand based competition binding assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetCannabinoid receptor 1(Rattus norvegicus (rat))
National And Kapodistrian University Of Athens

Curated by ChEMBL
LigandPNGBDBM50603266(CHEMBL5203712)
Affinity DataKi:  0.550nMAssay Description:Displacement of [3H]-CP-55,940 from CB1R in rat brain membranes measured by radioligand based competition binding assayMore data for this Ligand-Target Pair
In DepthDetails PubMed
LigandPNGBDBM370130(US10233188, Example 19 | US10800783, Example 19 | ...)
Affinity DataKi:  0.560nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetCannabinoid receptor 1(Rattus norvegicus (rat))
National And Kapodistrian University Of Athens

Curated by ChEMBL
LigandPNGBDBM50603279(CHEMBL5203974)
Affinity DataKi:  0.570nMAssay Description:Displacement of [3H]-CP-55,940 from CB1R in rat brain membranes measured by radioligand based competition binding assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetApelin receptor(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM50583266(CHEMBL5091501)
Affinity DataKi:  0.600nMAssay Description:Displacement of [125I]-[Nle75,Tyr77][Pyr1]-Ape13 from YFP-tagged human APJ expressed in HEK293 cell membranes assessed as inhibition constant incubat...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetApelin receptor(Homo sapiens (Human))
Universit£

Curated by ChEMBL
LigandPNGBDBM50583256(CHEMBL5087847)
Affinity DataKi:  0.600nMAssay Description:Displacement of [125I]-[Nle75,Tyr77][Pyr1]-Ape13 from YFP-tagged human APJ expressed in HEK293 cell membranes assessed as inhibition constant incubat...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361648(CHEMBL1940246)
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361649(CHEMBL1938415)
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
TargetCannabinoid receptor 1(Rattus norvegicus (rat))
National And Kapodistrian University Of Athens

Curated by ChEMBL
LigandPNGBDBM50603286(CHEMBL5183405)
Affinity DataKi:  0.610nMAssay Description:Displacement of [3H]-CP-55,940 from CB1R in rat brain membranes measured by radioligand based competition binding assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370133(US10233188, Example 22 | US10800783, Example 22 | ...)
Affinity DataKi:  0.610nMAssay Description:Inhibition of CDK2/cyclin E1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetCannabinoid receptor 1(Rattus norvegicus (rat))
National And Kapodistrian University Of Athens

Curated by ChEMBL
LigandPNGBDBM50603268(CHEMBL5206273)
Affinity DataKi:  0.660nMAssay Description:Displacement of [3H]-CP-55,940 from CB1R in rat brain membranes measured by radioligand based competition binding assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
LigandPNGBDBM370112(8-cyclopentyl-2-{[1-(methylsulfonyl)piperidin-4-yl...)
Affinity DataKi:  0.670nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin) assessed as reduction in substrate peptide phosphorylation using DYRKtide peptide as substrate preincub...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetCannabinoid receptor 1(Rattus norvegicus (rat))
National And Kapodistrian University Of Athens

Curated by ChEMBL
LigandPNGBDBM50603278(CHEMBL5176554)
Affinity DataKi:  0.690nMAssay Description:Displacement of [3H]-CP-55,940 from CB1R in rat brain membranes measured by radioligand based competition binding assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetCannabinoid receptor 2(MOUSE)
University Of Hawaii At Manoa

Curated by ChEMBL
LigandPNGBDBM50557516(CHEMBL4787347)
Affinity DataKi:  0.700nMAssay Description:Displacement of [3H]CP55940 from mouse CB2 receptor expressed in HEK293 cell membrane by scintillation counting methodMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361642(CHEMBL1940251)
Affinity DataKi:  0.700nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 1263 total ) | Next | Last >>
Jump to: