Compile Data Set for Download or QSAR
maximum 50k data
Found 91 of ic50 for UniProtKB: P06881
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50150463(CHEMBL3771371)
Affinity DataIC50:  0.110nMAssay Description:Displacement of [125I]CGRP from alpha CGRP in human SK-N-MC cells after 2 hrs by scintillation counterMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50356282(CHEMBL1910936)
Affinity DataIC50:  0.120nMAssay Description:Inhibition of human CGRP receptor expressed in huamn HEK293 cells coexpressing CLR/RAMP1 assessed as inhibition of CGRP-stimulated cAMP production af...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50246690(Ac-WVTHRLAGLLSRSGGVVRKNFVPTDVGPFAF-NH2 | CHEMBL503...)
Affinity DataIC50:  0.200nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50150464(CHEMBL3771314)
Affinity DataIC50:  0.230nMAssay Description:Displacement of [125I]CGRP from alpha CGRP in human SK-N-MC cells after 2 hrs by scintillation counterMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50246694(Ac-WVTHQLAGLLSQSGGVVRKNFVPTDVGPFAF-NH2 | CHEMBL524...)
Affinity DataIC50:  0.530nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50246691(Ac-WVTH[Cit]LAGLLSRSGGVVRKNFVPTDVGPFAF-NH2 | CHEMB...)
Affinity DataIC50:  0.570nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50246692(Ac-WVTHRLAGLLS[Cit]SGGVVRKNFVPTDVGPFAF-NH2 | CHEMB...)
Affinity DataIC50:  0.580nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50246687(CHEMBL500283 | WVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2)
Affinity DataIC50:  0.640nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50246689(Ac-VTHRLAGLLSRSGGVVRKNFVPTDVGPFAF-NH2 | CHEMBL5108...)
Affinity DataIC50:  0.710nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50246709(Ac-WVTH[Cit]LAGLLS[Cit]SGGVV[hArg]KNFVPTDVGP[2-Nal...)
Affinity DataIC50:  0.790nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50025074(CHEMBL2372188)
Affinity DataIC50:  0.850nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50246698(Ac-WVEHRLKGELSRKGGVV[hArg]KNFVPTDVGPFAF-NH2 | CHEM...)
Affinity DataIC50:  1nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50150396(CHEMBL3769439)
Affinity DataIC50:  1.10nMAssay Description:Displacement of [125I]CGRP from alpha CGRP in human SK-N-MC cells after 2 hrs by scintillation counterMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50025097(CHEMBL2372192)
Affinity DataIC50:  1.30nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50246697(Ac-WVTH[Cit]LAGLLS[Cit]SGGVV[hArg]KNFVPTDVGPFAF-NH...)
Affinity DataIC50:  1.30nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50246710(Ac-WVTH[Cit]LAGLLS[Cit]SGGVV[hArg]KNFVPTDVGP[Bip]A...)
Affinity DataIC50:  1.60nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50246693(Ac-WVTH[Cit]LAGLLS[Cit]SGGVVRKNFVPTDVGPFAF-NH2 | C...)
Affinity DataIC50:  1.70nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50246688(Ac-VTHRLAGLLSRSGGVVKNNFVPTDVGPFAF-NH2 | CHEMBL5093...)
Affinity DataIC50:  1.70nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50246696(Ac-WVTH[Cit]LAGLLS[Cit]SGGVV[hArg]KNFVPTDVGP[1-Nal...)
Affinity DataIC50:  1.80nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50246701(Ac-WVTH[Cit]LAGLLS[Cit]SGGVV[hArg]KNFVPTDVG[Thz]FA...)
Affinity DataIC50:  2nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50246695(Ac-WVTH[hArg]LAGLLS[hArg]SGGVVRKNFVPTDVGPFAF-NH2 |...)
Affinity DataIC50:  2.10nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50246708(Ac-WVTH[Cit]LAGLLS[Cit]SGGVV[hArg]KNFVPTDVGP[1-Nal...)
Affinity DataIC50:  2.20nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50224431(CHEMBL236593 | MK-0974 | N-[(3R,6S)-6-(2,3-difluor...)
Affinity DataIC50:  2.20nMAssay Description:Inhibition of human CGRP receptor expressed in huamn HEK293 cells coexpressing CLR/RAMP1 assessed as inhibition of CGRP-stimulated cAMP production af...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50025073(CHEMBL2372187)
Affinity DataIC50:  2.20nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50150450(CHEMBL3769667)
Affinity DataIC50:  2.90nMAssay Description:Displacement of [125I]CGRP from alpha CGRP in human SK-N-MC cells after 2 hrs by scintillation counterMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50025075(CHEMBL2372193)
Affinity DataIC50:  3.5nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50246700(Ac-WVTH[Cit]LAGLLS[Cit]SGGVV[hArg]KNFVPTDVG[Aib]FA...)
Affinity DataIC50:  3.5nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50025076(CHEMBL2372194)
Affinity DataIC50:  3.60nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50246704(Ac-WVTH[Cit]LAGLLS[Cit]SGGVV[hArg]KNFVPTDVG[Sar]FA...)
Affinity DataIC50:  3.80nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50025095(CHEMBL2372190)
Affinity DataIC50:  4.20nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50150456(CHEMBL3770964)
Affinity DataIC50:  4.30nMAssay Description:Displacement of [125I]CGRP from alpha CGRP in human SK-N-MC cells after 2 hrs by scintillation counterMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50000743(CHEMBL525571 | [Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Se...)
Affinity DataIC50:  4.90nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50246699(Ac-WVTH[Cit]LAGLLS[Cit]SGGVV[hArg]KNFVPTDVG[Hyp]FA...)
Affinity DataIC50:  5nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50150454(CHEMBL3770165)
Affinity DataIC50:  7nMAssay Description:Displacement of [125I]CGRP from alpha CGRP in human SK-N-MC cells after 2 hrs by scintillation counterMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50150288(CHEMBL3769848)
Affinity DataIC50:  8.90nMAssay Description:Displacement of [125I]CGRP from alpha CGRP in human SK-N-MC cells after 2 hrs by scintillation counterMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50150447(CHEMBL3770217)
Affinity DataIC50:  9.80nMAssay Description:Displacement of [125I]CGRP from alpha CGRP in human SK-N-MC cells after 2 hrs by scintillation counterMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50246705(Ac-WVTH[Cit]LAGLLS[Cit]SGGVV[hArg]KNFVPTDVG[Pip]FA...)
Affinity DataIC50:  11nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50150455(CHEMBL3769749)
Affinity DataIC50:  12nMAssay Description:Displacement of [125I]CGRP from alpha CGRP in human SK-N-MC cells after 2 hrs by scintillation counterMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50150388(CHEMBL3771271)
Affinity DataIC50:  12nMAssay Description:Displacement of [125I]CGRP from alpha CGRP in human SK-N-MC cells after 2 hrs by scintillation counterMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50150401(CHEMBL3770508)
Affinity DataIC50:  13nMAssay Description:Displacement of [125I]CGRP from alpha CGRP in human SK-N-MC cells after 2 hrs by scintillation counterMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50150465(CHEMBL3770364)
Affinity DataIC50:  14nMAssay Description:Displacement of [125I]CGRP from alpha CGRP in human SK-N-MC cells after 2 hrs by scintillation counterMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50150392(CHEMBL3771103)
Affinity DataIC50:  15nMAssay Description:Displacement of [125I]CGRP from alpha CGRP in human SK-N-MC cells after 2 hrs by scintillation counterMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50150394(CHEMBL3770407)
Affinity DataIC50:  16nMAssay Description:Displacement of [125I]CGRP from alpha CGRP in human SK-N-MC cells after 2 hrs by scintillation counterMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50150391(CHEMBL3769428)
Affinity DataIC50:  19nMAssay Description:Displacement of [125I]CGRP from alpha CGRP in human SK-N-MC cells after 2 hrs by scintillation counterMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50150395(CHEMBL3769533)
Affinity DataIC50:  19nMAssay Description:Displacement of [125I]CGRP from alpha CGRP in human SK-N-MC cells after 2 hrs by scintillation counterMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50150387(CHEMBL3770378)
Affinity DataIC50:  22nMAssay Description:Displacement of [125I]CGRP from alpha CGRP in human SK-N-MC cells after 2 hrs by scintillation counterMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50150467(CHEMBL3769892)
Affinity DataIC50:  24nMAssay Description:Displacement of [125I]CGRP from alpha CGRP in human SK-N-MC cells after 2 hrs by scintillation counterMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50025092(CHEMBL2372189)
Affinity DataIC50:  30nMAssay Description:Antagonist activity at human CGRP1 receptor in human SK-N-MC cells assessed as effect on human alpha-CGRP-induced cAMP accumulationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50150386(CHEMBL3769654)
Affinity DataIC50:  33nMAssay Description:Displacement of [125I]CGRP from alpha CGRP in human SK-N-MC cells after 2 hrs by scintillation counterMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcitonin gene-related peptide 1(Homo sapiens (Human))
Bristol-Myers Squibb Discovery

Curated by ChEMBL
LigandPNGBDBM50150451(CHEMBL3770496)
Affinity DataIC50:  34nMAssay Description:Displacement of [125I]CGRP from alpha CGRP in human SK-N-MC cells after 2 hrs by scintillation counterMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 91 total ) | Next | Last >>
Jump to: