Compile Data Set for Download or QSAR
maximum 50k data
Found 99 of affinity data for UniProtKB/TrEMBL: P47211
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273370(CHEMBL503473 | GWTLNSAGYLLGPPPGFSPFR-CONH2 | Galan...)
Affinity DataKi:  0.0100nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50378616(GALANIN)
Affinity DataKi:  0.0300nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273369(CHEMBL526003 | GWTLNSAGYLLGPQQFFGLM-CONH2 | Galani...)
Affinity DataKi:  0.0300nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307256(CHEMBL604373 | GWTLNSAGYLLGPrPKPQQwFwLL-CONH2 | Ga...)
Affinity DataKi:  0.0800nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307254(CHEMBL604990 | GWTLNSAGYLLGPPPALALA-CONH2 | M40)
Affinity DataKi:  0.100nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273370(CHEMBL503473 | GWTLNSAGYLLGPPPGFSPFR-CONH2 | Galan...)
Affinity DataKi:  0.110nMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM85070(Galanin, Porcine)
Affinity DataKi:  0.230nMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM85073(CAS_3043476 | Galantide (M15) | NSC_3043476)
Affinity DataKi:  0.25nMMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM85168(M32)
Affinity DataKi:  0.260nMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM85200(Galanin (1-19), rat | Galanin rat)
Affinity DataKi:  0.290nMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307255(CHEMBL592413 | GWTLNSAGYLLGPRHYINLITRQRY-CONH2)
Affinity DataKi:  0.300nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273353((S)-1-(2-((S)-2-((S)-2-((S)-2-(2-((S)-2-((S)-2-((S...)
Affinity DataKi:  0.400nMAssay Description:Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50293023((Sar)WTLNSAGYLLGPKKKK | CHEMBL508036)
Affinity DataKi:  0.400nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR1 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM85072(Galanin, Human)
Affinity DataKi:  0.440nMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50378616(GALANIN)
Affinity DataKi:  0.460nMAssay Description:Binding affinity to human GAL1 receptor by radioligand displacement assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50293024((Sar)WTLNSAGYLLGPKK(Lys-MPEG4)K | CHEMBL505299)
Affinity DataKi:  0.5nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR1 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273351(CHEMBL508083 | GWTLNSAGYLLGPHAV-NH2)
Affinity DataKi:  0.5nMAssay Description:Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50293030((Sar)WTLNSAGYLLGPKK(Lys-octanoyl)K | CHEMBL503900)
Affinity DataKi:  0.700nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR1 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273359(CHEMBL526500)
Affinity DataKi:  0.900nMAssay Description:Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50293029((Sar)WTLNSAGYLLGPKK(Lys-decanoyl)K | CHEMBL460706)
Affinity DataKi:  1.30nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR1 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50293028((Sar)WTLNSAGYLLGPKK(Lys-lauroyl)K | CHEMBL507733)
Affinity DataKi:  1.40nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR1 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307258(CHEMBL578317 | [N-Ac,des-Sar]Gal-B2)
Affinity DataKi:  1.70nMAssay Description:Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273354(CHEMBL525755)
Affinity DataKi:  1.90nMAssay Description:Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307254(CHEMBL604990 | GWTLNSAGYLLGPPPALALA-CONH2 | M40)
Affinity DataKi:  2.40nMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50293027((Sar)WTLNSAGYLLGPKK(Lys-myristoyl)K | CHEMBL524678)
Affinity DataKi:  2.60nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR1 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273360((S)-N-((S)-6-amino-1-((S)-6-amino-1-((S)-1-((S)-1,...)
Affinity DataKi:  2.80nMAssay Description:Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273367((2S,3S)-2-((S)-2-((S)-2-((S)-1-(2-((S)-2-((S)-2-((...)
Affinity DataKi:  2.88nMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273362(CHEMBL505336)
Affinity DataKi:  3.30nMAssay Description:Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50293026((Sar)WTLNSAGYLLGPKK(Lys-palmitoyl)K | CHEMBL507353)
Affinity DataKi:  3.5nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR1 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273355(CHEMBL525023)
Affinity DataKi:  3.5nMAssay Description:Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307250(CHEMBL578514 | GalB2)
Affinity DataKi:  3.5nMAssay Description:Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307250(CHEMBL578514 | GalB2)
Affinity DataKi:  3.5nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50426597(CHEMBL2324950)
Affinity DataKi:  3.80nMAssay Description:Displacement of euporium-galanin from human GalR1 after 1.5 hrs by DELFIA assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50293025((Sar)WTLNSAGYLLGPKK(Lys-stearoyl)K | CHEMBL450827)
Affinity DataKi:  4nMAssay Description:Displacement of europium labeled galanin from human recombinant GalR1 receptor by time-resolved fluorescence binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273360((S)-N-((S)-6-amino-1-((S)-6-amino-1-((S)-1-((S)-1,...)
Affinity DataKi:  5.30nMAssay Description:Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273356(CHEMBL504914)
Affinity DataKi:  6nMAssay Description:Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307257(CHEMBL578910 | [Sar1Ala]GAL-B2)
Affinity DataKi:  11nMAssay Description:Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273370(CHEMBL503473 | GWTLNSAGYLLGPPPGFSPFR-CONH2 | Galan...)
Affinity DataKi:  11.5nMMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273361((S)-N-((S)-6-amino-1-((S)-6-amino-1-((S)-1-((S)-1,...)
Affinity DataKi:  22nMAssay Description:Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM85070(Galanin, Porcine)
Affinity DataKi:  25.2nMMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273357(CHEMBL501306)
Affinity DataKi:  26nMAssay Description:Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273364((S)-2-((S)-2-((S)-2-((S)-2-(2-((S)-2-((S)-2-((S)-2...)
Affinity DataKi:  26nMAssay Description:Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM85069(Galanin (2-29), rat | Galanin Porcine 2-29)
Affinity DataKi:  26.3nMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273369(CHEMBL526003 | GWTLNSAGYLLGPQQFFGLM-CONH2 | Galani...)
Affinity DataKi:  27.4nMMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM85072(Galanin, Human)
Affinity DataKi:  30.9nMMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50426598(CHEMBL2324949)
Affinity DataKi:  38nMAssay Description:Displacement of euporium-galanin from human GalR1 after 1.5 hrs by DELFIA assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273363(CHEMBL526889)
Affinity DataKi:  42nMAssay Description:Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307253(CHEMBL592415 | WTLNSAGYLLGPHAVGNHPSFSDKNGLTS-CONH2)
Affinity DataKi:  51nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273352((S)-1-(2-((S)-2-((S)-2-((S)-2-(2-((S)-2-((S)-2-((S...)
Affinity DataKi:  85nMAssay Description:Displacement of europium-labeled galanin from human GalR1 expressed in HEK293 EBNA cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM85205(Galanin (1-16) | Galanin (1-16), rat)
Affinity DataKi:  106nMMore data for this Ligand-Target Pair
In DepthDetails PubMed
Displayed 1 to 50 (of 99 total ) | Next | Last >>
Jump to: