BindingDB logo
myBDB logout

BDBM148264 7-cyclopentyl-N,N-dimethyl-2-((5-(piperazin-1-yl)pyridin-2-yl)amino)-7H-pyrrolo[2,3-d]pyrimidine-6-carboxamide::Kisqali::LEE011::Ribociclib::US10570141, Comparative Example 1::US8962630, 74

SMILES: CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1


Data: 41 IC50

PDB links: 1 PDB ID matches this monomer.

Find this compound or compounds like it in BindingDB:
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 41 hits for monomerid = 148264   
Trg + Lig
Cyclin-dependent kinase 1

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

Reactome pathway



PC cid
PC sid


US Patent

Novartis AG

US Patent

Assay Description
A 384-well microtiter IMAP-FPT (Molecular Devices Trade Mark Technology) endpoint assay was used for CDK1/cyclin B kinase activity measurements. The ...

US Patent US8962630 (2015)

BindingDB Entry DOI: 10.7270/Q2RJ4H6C
More data for this
Ligand-Target Pair
Cyclin-Dependent Kinase 4 (CDK4)

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

NCI pathway
Reactome pathway



PC cid
PC sid


n/an/a 23n/an/an/an/an/an/a

Chinese Academy of Medical Sciences and Peking Union Medical College

Curated by ChEMBL

Assay Description
Inhibition of CDK4/cyclin D1 (unknown origin)

Bioorg Med Chem Lett 33: (2021)

More data for this
Ligand-Target Pair
Cyclin-dependent kinase 4

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

NCI pathway
Reactome pathway



PC cid
PC sid


US Patent
n/an/a 10n/an/an/an/a7.525

Novartis AG

US Patent

Assay Description
A 384-well microtiter Lance TR-FRET (time-resolved-fluorescence energy transfer) endpoint assay was used for CDK4/cyclin D1 kinase activity measureme...

US Patent US8962630 (2015)

BindingDB Entry DOI: 10.7270/Q2RJ4H6C
More data for this
Ligand-Target Pair
Cyclin-dependent kinase 1

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

Reactome pathway



PC cid
PC sid


US Patent
n/an/a 1.13E+5n/an/an/an/an/a25

Novartis AG

US Patent

Assay Description
A 384-well microtiter IMAP-FPT (Molecular Devices Trade Mark Technology) endpoint assay was used for CDK1/cyclin B kinase activity measurements. The ...

US Patent US8962630 (2015)

BindingDB Entry DOI: 10.7270/Q2RJ4H6C
More data for this
Ligand-Target Pair
Cyclin-dependent kinase 2

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

NCI pathway
Reactome pathway



PC cid
PC sid


US Patent
n/an/a 7.60E+4n/an/an/an/an/an/a

Novartis AG

US Patent

Assay Description
The assay was run under the conditions identical to that for CDK1/cyclin B except 0.25 nM CDK1/cyclin B was replaced with 0.3 nM CDK2/cyclin A. A 384...

US Patent US8962630 (2015)

BindingDB Entry DOI: 10.7270/Q2RJ4H6C
More data for this
Ligand-Target Pair
Cyclin-dependent kinase 6

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

NCI pathway
Reactome pathway



PC cid
PC sid


n/an/a 39n/an/an/an/an/an/a

Eli Lilly and Company

Curated by ChEMBL

Assay Description
Inhibition of CDK6 (unknown origin)

Bioorg Med Chem Lett 25: 3420-35 (2015)

Article DOI: 10.1016/j.bmcl.2015.05.100
BindingDB Entry DOI: 10.7270/Q2736SQ1
More data for this
Ligand-Target Pair
3D Structure (crystal)
Cyclin-dependent kinase 4

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

NCI pathway
Reactome pathway



PC cid
PC sid


n/an/a 10n/an/an/an/an/an/a

Eli Lilly and Company

Curated by ChEMBL

Assay Description
Inhibition of CDK4 (unknown origin)

Bioorg Med Chem Lett 25: 3420-35 (2015)

Article DOI: 10.1016/j.bmcl.2015.05.100
BindingDB Entry DOI: 10.7270/Q2736SQ1
More data for this
Ligand-Target Pair
CDK4/Cyclin D3

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)




PC cid
PC sid


n/an/a 13n/an/an/an/an/an/a

Nankai University

Curated by ChEMBL

Assay Description
Inhibition of human CDK4/CyclinD3 by enzymatic radiometric assay

Bioorg Med Chem Lett 27: 3231-3237 (2017)

Article DOI: 10.1016/j.bmcl.2017.06.041
BindingDB Entry DOI: 10.7270/Q2JS9SW3
More data for this
Ligand-Target Pair
Cyclin-Dependent Kinase 9 (CDK9)

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

Reactome pathway



PC cid
PC sid


n/an/a 197n/an/an/an/an/an/a

Nankai University

Curated by ChEMBL

Assay Description
Inhibition of human CDK9/CyclinT1 by enzymatic radiometric assay

Bioorg Med Chem Lett 27: 3231-3237 (2017)

Article DOI: 10.1016/j.bmcl.2017.06.041
BindingDB Entry DOI: 10.7270/Q2JS9SW3
More data for this
Ligand-Target Pair
Cyclin-Dependent Kinase 9 (CDK9)

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

Reactome pathway



PC cid
PC sid


n/an/a 197n/an/an/an/an/an/a

Nankai University

Curated by ChEMBL

Assay Description
Binding affinity towards [3H]quipazine labeled 5-hydroxytryptamine 3 receptor sites in HG108-15

J Med Chem 61: 3166-3192 (2018)

Article DOI: 10.1021/acs.jmedchem.8b00209
BindingDB Entry DOI: 10.7270/Q2KS6TZK
More data for this
Ligand-Target Pair
CDK4/Cyclin D3

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)




PC cid
PC sid


n/an/a 13n/an/an/an/an/an/a

Nankai University

Curated by ChEMBL

Assay Description
Binding affinity towards [3H]quipazine labeled 5-hydroxytryptamine 3 receptor sites in HG108-15

J Med Chem 61: 3166-3192 (2018)

Article DOI: 10.1021/acs.jmedchem.8b00209
BindingDB Entry DOI: 10.7270/Q2KS6TZK
More data for this
Ligand-Target Pair

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)



PC cid
PC sid


n/an/a 28n/an/an/an/an/an/a

Beijing Normal University

Curated by ChEMBL

Assay Description
Inhibition of CDK6/Cyclin-D3 (unknown origin) using histoneH1 as substrate after 90 mins by ADP-Glo assay

Eur J Med Chem 144: 1-28 (2018)

Article DOI: 10.1016/j.ejmech.2017.12.003
BindingDB Entry DOI: 10.7270/Q28C9ZX0
More data for this
Ligand-Target Pair
3D Structure (crystal)
Cyclin-dependent kinase 4

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

NCI pathway
Reactome pathway



PC cid
PC sid


n/an/a 2n/an/an/an/an/an/a

Central University of Punjab

Curated by ChEMBL

Assay Description
Inhibition of CDK4 (unknown origin)

Eur J Med Chem 142: 424-458 (2017)

Article DOI: 10.1016/j.ejmech.2017.08.071
BindingDB Entry DOI: 10.7270/Q2S1856W
More data for this
Ligand-Target Pair
Cyclin-dependent kinase 6

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

NCI pathway
Reactome pathway



PC cid
PC sid


n/an/a 6n/an/an/an/an/an/a

Central University of Punjab

Curated by ChEMBL

Assay Description
Inhibition of CDK6 (unknown origin)

Eur J Med Chem 142: 424-458 (2017)

Article DOI: 10.1016/j.ejmech.2017.08.071
BindingDB Entry DOI: 10.7270/Q2S1856W
More data for this
Ligand-Target Pair
3D Structure (crystal)
Cyclin-dependent kinase 4

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

NCI pathway
Reactome pathway



PC cid
PC sid


US Patent
n/an/a 2.14n/an/an/an/an/an/a


US Patent

Assay Description
LANCE method of PerkinElmer Inc. was used in the assay, and recombinant CDK4/CyclinD3 (Item No.: 04-105) and CDK6/CyclinD3 (Item No.: 04-107) kinases...

US Patent US10570141 (2020)

BindingDB Entry DOI: 10.7270/Q2RV0R3H
More data for this
Ligand-Target Pair
Cyclin-dependent kinase 6

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

NCI pathway
Reactome pathway



PC cid
PC sid


US Patent
n/an/a 26.9n/an/an/an/an/an/a


US Patent

Assay Description
LANCE method of PerkinElmer Inc. was used in the assay, and recombinant CDK4/CyclinD3 (Item No.: 04-105) and CDK6/CyclinD3 (Item No.: 04-107) kinases...

US Patent US10570141 (2020)

BindingDB Entry DOI: 10.7270/Q2RV0R3H
More data for this
Ligand-Target Pair
3D Structure (crystal)
Cyclin-Dependent Kinase 1 (CDK1)

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

Reactome pathway



PC cid
PC sid



Palack£ University and Institute of Experimental Botany ASCR

Curated by ChEMBL

Assay Description
Inhibition of His-tagged CDK1/cyclin B1 (unknown origin) expressed in Baculovirus infected Sf9 cells using histone H1 as substrate in presence of [ga...

J Med Chem 61: 9105-9120 (2018)

Article DOI: 10.1021/acs.jmedchem.8b00049
More data for this
Ligand-Target Pair
Cyclin-Dependent Kinase 2 (CDK2)

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

NCI pathway
Reactome pathway



PC cid
PC sid



Palack£ University and Institute of Experimental Botany ASCR

Curated by ChEMBL

Assay Description
Inhibition of GST-tagged CDK2/cyclin A2 (unknown origin) expressed in Escherichia coli using histone H1 as substrate in presence of [gamma-33P]-ATP b...

J Med Chem 61: 9105-9120 (2018)

Article DOI: 10.1021/acs.jmedchem.8b00049
More data for this
Ligand-Target Pair
CDK7/Cyclin H/MNAT1

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)



PC cid
PC sid



Palack£ University and Institute of Experimental Botany ASCR

Curated by ChEMBL

Assay Description
Inhibition of GST-tagged CDK7/cyclinH/MAT1 (unknown origin) expressed in Baculovirus infected Sf9 cells using YSPTSPS-2 KK peptide as substrate as su...

J Med Chem 61: 9105-9120 (2018)

Article DOI: 10.1021/acs.jmedchem.8b00049
More data for this
Ligand-Target Pair
Cyclin-Dependent Kinase 9 (CDK9)

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

Reactome pathway



PC cid
PC sid


n/an/a 3.90E+3n/an/an/an/an/an/a

Palack£ University and Institute of Experimental Botany ASCR

Curated by ChEMBL

Assay Description
Inhibition of GST-tagged CDK9/CyclinT1 (unknown origin) expressed in Baculovirus infected Sf9 cells using YSPTSPS-2 KK peptide as substrate as substr...

J Med Chem 61: 9105-9120 (2018)

Article DOI: 10.1021/acs.jmedchem.8b00049
More data for this
Ligand-Target Pair
Cyclin-Dependent Kinase 5 (CDK5)

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

NCI pathway
Reactome pathway



PC cid
PC sid



Palack£ University and Institute of Experimental Botany ASCR

Curated by ChEMBL

Assay Description
Inhibition of GST-tagged CDK5/p25 (unknown origin) expressed in Baculovirus infected Sf9 cells using histone H1 as substrate as substrate in presence...

J Med Chem 61: 9105-9120 (2018)

Article DOI: 10.1021/acs.jmedchem.8b00049
More data for this
Ligand-Target Pair

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

Reactome pathway



PC cid
PC sid



Palack£ University and Institute of Experimental Botany ASCR

Curated by ChEMBL

Assay Description
Inhibition of His-tagged CDK2/cyclin E (unknown origin) expressed in Baculovirus infected Sf9 cells using histone H1 as substrate in presence of [gam...

J Med Chem 61: 9105-9120 (2018)

Article DOI: 10.1021/acs.jmedchem.8b00049
More data for this
Ligand-Target Pair
Cyclin-Dependent Kinase 4 (CDK4)

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

NCI pathway
Reactome pathway



PC cid
PC sid


n/an/a 30n/an/an/an/an/an/a

Palack£ University and Institute of Experimental Botany ASCR

Curated by ChEMBL

Assay Description
Inhibition of GST-tagged CDK4/cyclin D1 (unknown origin) expressed in Baculovirus infected Sf9 cells using RPPTLSPIPHIPR peptide as substrate in pres...

J Med Chem 61: 9105-9120 (2018)

Article DOI: 10.1021/acs.jmedchem.8b00049
More data for this
Ligand-Target Pair

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)



PC cid
PC sid


n/an/a 71n/an/an/an/an/an/a

Nankai University

Curated by ChEMBL

Assay Description
Inhibition of recombinant full-length human CDK6/cyclinD3 using histone H1 as substrate measured after 40 mins in presence of [gamma33P]ATP by scinti...

Eur J Med Chem 181: (2019)

Article DOI: 10.1016/j.ejmech.2019.07.038
More data for this
Ligand-Target Pair
3D Structure (crystal)
Cyclin-Dependent Kinase 9 (CDK9)

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

Reactome pathway



PC cid
PC sid


n/an/a 197n/an/an/an/an/an/a

Nankai University

Curated by ChEMBL

Assay Description
Inhibition of recombinant full-length human CDK9/cyclinT1 using [protein fragment, 39 aa] peptide as substrate measured after 40 mins i...

Eur J Med Chem 181: (2019)

Article DOI: 10.1016/j.ejmech.2019.07.038
More data for this
Ligand-Target Pair
CDK4/Cyclin D3

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)




PC cid
PC sid


n/an/a 13n/an/an/an/an/an/a

Nankai University

Curated by ChEMBL

Assay Description
Inhibition of recombinant full-length human CDK4/cyclinD3 using Rb fragment as substrate measured after 40 mins in presence of [gamma33P]ATP by scint...

Eur J Med Chem 181: (2019)

Article DOI: 10.1016/j.ejmech.2019.07.038
More data for this
Ligand-Target Pair
Cyclin-dependent kinase 4

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

NCI pathway
Reactome pathway



PC cid
PC sid


n/an/a 10n/an/an/an/an/an/a

University of Padova

Curated by ChEMBL

Assay Description
Inhibition of CDK4 (unknown origin)

Eur J Med Chem 172: 143-153 (2019)

Article DOI: 10.1016/j.ejmech.2019.03.064
More data for this
Ligand-Target Pair
Cyclin-dependent kinase 6

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

NCI pathway
Reactome pathway



PC cid
PC sid


n/an/a 39n/an/an/an/an/an/a

University of Padova

Curated by ChEMBL

Assay Description
Inhibition of CDK6 (unknown origin)

Eur J Med Chem 172: 143-153 (2019)

Article DOI: 10.1016/j.ejmech.2019.03.064
More data for this
Ligand-Target Pair
3D Structure (crystal)
Cyclin-Dependent Kinase 2 (CDK2)

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

NCI pathway
Reactome pathway



PC cid
PC sid


n/an/a 7.60E+4n/an/an/an/an/an/a

University of Padova

Curated by ChEMBL

Assay Description
Inhibition of CDK2/CyclinA (unknown origin) assessed as reduction in TAMRA tagged peptide substrate phosphorylation by fluorescence polarization assa...

Eur J Med Chem 172: 143-153 (2019)

Article DOI: 10.1016/j.ejmech.2019.03.064
More data for this
Ligand-Target Pair
Cyclin-Dependent Kinase 4 (CDK4)

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

NCI pathway
Reactome pathway



PC cid
PC sid


n/an/a 10n/an/an/an/an/an/a

University of Padova

Curated by ChEMBL

Assay Description
Inhibition of CDK4/CyclinD1 (unknown origin) assessed as reduction in retinoblastoma phosphorylation at S473 residue by ELISA

Eur J Med Chem 172: 143-153 (2019)

Article DOI: 10.1016/j.ejmech.2019.03.064
More data for this
Ligand-Target Pair
Cyclin-dependent kinase 2

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

NCI pathway
Reactome pathway



PC cid
PC sid



University of Padova

Curated by ChEMBL

Assay Description
Inhibition of CDK2 (unknown origin)

Eur J Med Chem 172: 143-153 (2019)

Article DOI: 10.1016/j.ejmech.2019.03.064
More data for this
Ligand-Target Pair
Protein cereblon/Cyclin-dependent kinase 2

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

NCI pathway
Reactome pathway



PC cid
PC sid



The First Affiliated Hospital of Zhengzhou University

Curated by ChEMBL

Assay Description
Inhibition of CDK2 (unknown origin)

Eur J Med Chem 164: 615-639 (2019)

Article DOI: 10.1016/j.ejmech.2019.01.003
More data for this
Ligand-Target Pair
Cyclin-dependent kinase 1

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

Reactome pathway



PC cid
PC sid



The First Affiliated Hospital of Zhengzhou University

Curated by ChEMBL

Assay Description
Inhibition of CDK1 (unknown origin)

Eur J Med Chem 164: 615-639 (2019)

Article DOI: 10.1016/j.ejmech.2019.01.003
More data for this
Ligand-Target Pair
Cyclin-Dependent Kinase 1 (CDK1)

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

Reactome pathway



PC cid
PC sid



ShanghaiTech University

Curated by ChEMBL

Assay Description
Inhibition of CDK1/cyclin B1 (unknown origin) using FAM-labeled peptide and ATP as substrate preincubated for 10 mins followed by substrate addition ...

Eur J Med Chem 215: (2021)

More data for this
Ligand-Target Pair
Cyclin-Dependent Kinase 4 (CDK4)

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

NCI pathway
Reactome pathway



PC cid
PC sid


n/an/a 30n/an/an/an/an/an/a

ShanghaiTech University

Curated by ChEMBL

Assay Description
Inhibition of human CDK4/cyclin D (unknown origin) using FAM-labeled peptide and ATP as substrate preincubated for 10 mins followed by substrate addi...

Eur J Med Chem 215: (2021)

More data for this
Ligand-Target Pair

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

Reactome pathway



PC cid
PC sid



ShanghaiTech University

Curated by ChEMBL

Assay Description
Inhibition of human CDK2/cyclin E (unknown origin) using FAM-labeled peptide and ATP as substrate preincubated for 10 mins followed by substrate addi...

Eur J Med Chem 215: (2021)

More data for this
Ligand-Target Pair

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)



PC cid
PC sid


n/an/a 73n/an/an/an/an/an/a

Nankai University

Curated by ChEMBL

Assay Description
Inhibition of CDK6/Cyclin D (unknown origin)

Eur J Med Chem 209: (2021)

More data for this
Ligand-Target Pair
3D Structure (crystal)
Cyclin-Dependent Kinase 4 (CDK4)

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

NCI pathway
Reactome pathway



PC cid
PC sid


n/an/a 29n/an/an/an/an/an/a

Nankai University

Curated by ChEMBL

Assay Description
Inhibition of CDK4/cyclin D1 (unknown origin)

Eur J Med Chem 209: (2021)

More data for this
Ligand-Target Pair

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

Reactome pathway



PC cid
PC sid



Nankai University

Curated by ChEMBL

Assay Description
Inhibition of CDK2/Cyclin E (unknown origin)

Eur J Med Chem 209: (2021)

More data for this
Ligand-Target Pair
CDK6/cyclin D1

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)




PC cid
PC sid


n/an/a 20n/an/an/an/an/an/a

Chinese Academy of Medical Sciences and Peking Union Medical College

Curated by ChEMBL

Assay Description
Inhibition of CDK6/cyclin D1 (unknown origin)

Bioorg Med Chem Lett 33: (2021)

More data for this
Ligand-Target Pair
3D Structure (crystal)
Cyclin-dependent kinase 2

(Homo sapiens (Human))
Show SMILES CN(C)C(=O)c1cc2cnc(Nc3ccc(cn3)N3CCNCC3)nc2n1C1CCCC1
Show InChI InChI=1S/C23H30N8O/c1-29(2)22(32)19-13-16-14-26-23(28-21(16)31(19)17-5-3-4-6-17)27-20-8-7-18(15-25-20)30-11-9-24-10-12-30/h7-8,13-15,17,24H,3-6,9-12H2,1-2H3,(H,25,26,27,28)

NCI pathway
Reactome pathway



PC cid
PC sid


US Patent

Novartis AG

US Patent

Assay Description
The assay was run under the conditions identical to that for CDK1/cyclin B except 0.25 nM CDK1/cyclin B was replaced with 0.3 nM CDK2/cyclin A. A 384...

US Patent US8962630 (2015)

BindingDB Entry DOI: 10.7270/Q2RJ4H6C
More data for this
Ligand-Target Pair