BDBM50261506 CHEMBL499930::HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH2
SMILES CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)Cc1cnc[nH]1)[C@@H](C)O)[C@@H](C)O)C(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(N)=O
InChI Key InChIKey=FZWMHWVGNYURLN-AAEALURTSA-N
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 6 hits for monomerid = 50261506
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland
Curated by ChEMBL
The University Of Queensland
Curated by ChEMBL
Affinity DataKi: 0.320nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland
Curated by ChEMBL
The University Of Queensland
Curated by ChEMBL
Affinity DataEC50: 0.00600nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as increase in cAMP level by cAMP-response element/luciferase activation assayMore data for this Ligand-Target Pair
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland
Curated by ChEMBL
The University Of Queensland
Curated by ChEMBL
Affinity DataEC50: 3.70nMAssay Description:Agonist activity at human GLP1R expressed in CHOK1 cells assessed as induction of beta-galactosidase-tagged beta-arrestin2 recruitment incubated for ...More data for this Ligand-Target Pair
TargetGlucagon-like peptide 1 receptor(Rattus norvegicus)
The University Of Queensland
Curated by ChEMBL
The University Of Queensland
Curated by ChEMBL
Affinity DataEC50: 0.900nMAssay Description:Agonist activity at GLP1R in rat INS-1 cells assessed as increase in glucose-stimulated insulin secretion after 1 hr by HTRF assayMore data for this Ligand-Target Pair
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland
Curated by ChEMBL
The University Of Queensland
Curated by ChEMBL
Affinity DataIC50: 1.70nMAssay Description:Displacement of [125I]GLP1 from human GLP1R expressed in CHOK1 cellsMore data for this Ligand-Target Pair
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland
Curated by ChEMBL
The University Of Queensland
Curated by ChEMBL
Affinity DataEC50: 0.0600nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair