Found 224 with Last Name = 'alton' and Initial = 'g' 
Affinity DataKi: 0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
3D Structure (crystal)
Affinity DataKi: 0.700nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 0.900nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Inhibition of human activated c-Met by PK/LDH coupled kinetic assayMore data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1.30nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 1.75nM ΔG°: -49.5kJ/molepH: 7.4 T: 2°CAssay Description:The inhibitors reported in this study bind to CHK1 according to a general mechanism illustrated in Scheme 1 where E, S, and I stand for enzyme, subst...More data for this Ligand-Target Pair
Affinity DataKi: 2nMAssay Description:Inhibition of human activated c-Met by PK/LDH coupled kinetic assayMore data for this Ligand-Target Pair
Affinity DataKi: 2nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 2nMAssay Description:Binding affinity to human recombinant c-MET assessed as inhibition of autophosphorylation by continuous fluorometric assayMore data for this Ligand-Target Pair
Affinity DataKi: 2.5nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 3nMAssay Description:Inhibition of human activated c-Met by PK/LDH coupled kinetic assayMore data for this Ligand-Target Pair
Affinity DataKi: 5.14nM ΔG°: -46.5kJ/molepH: 8.0 T: 2°CAssay Description:Surface plasmon resonance (SPR) biosensor binding studies were conducted using a Biacore 3000 instrument (GE Healtchare).More data for this Ligand-Target Pair
Affinity DataKi: 10nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
Affinity DataKi: 12nMAssay Description:Binding affinity to human recombinant c-MET assessed as inhibition of autophosphorylation by continuous fluorometric assayMore data for this Ligand-Target Pair
Affinity DataKi: 14nMAssay Description:Binding affinity to human recombinant c-MET assessed as inhibition of autophosphorylation by continuous fluorometric assayMore data for this Ligand-Target Pair
Affinity DataKi: 19nMAssay Description:Binding affinity to human recombinant c-MET assessed as inhibition of autophosphorylation by continuous fluorometric assayMore data for this Ligand-Target Pair
Affinity DataKi: 24nMAssay Description:Binding affinity to human recombinant c-MET assessed as inhibition of autophosphorylation by continuous fluorometric assayMore data for this Ligand-Target Pair
Affinity DataKi: 26nMAssay Description:Binding affinity to human recombinant c-MET assessed as inhibition of autophosphorylation by continuous fluorometric assayMore data for this Ligand-Target Pair
Affinity DataKi: 35nMAssay Description:Binding affinity to human recombinant c-MET assessed as inhibition of autophosphorylation by continuous fluorometric assayMore data for this Ligand-Target Pair
Affinity DataKi: 35nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 35nMAssay Description:Binding affinity to human recombinant c-MET assessed as inhibition of autophosphorylation by continuous fluorometric assayMore data for this Ligand-Target Pair
Affinity DataKi: 37nMAssay Description:Binding affinity to human recombinant c-MET assessed as inhibition of autophosphorylation by continuous fluorometric assayMore data for this Ligand-Target Pair
Affinity DataKi: 38nMAssay Description:Binding affinity to human recombinant c-MET assessed as inhibition of autophosphorylation by continuous fluorometric assayMore data for this Ligand-Target Pair
Affinity DataKi: 41nMAssay Description:Binding affinity to human recombinant c-MET assessed as inhibition of autophosphorylation by continuous fluorometric assayMore data for this Ligand-Target Pair
Affinity DataKi: 46nMAssay Description:Binding affinity to human recombinant c-MET assessed as inhibition of autophosphorylation by continuous fluorometric assayMore data for this Ligand-Target Pair
Affinity DataKi: 46nMAssay Description:Binding affinity to human recombinant c-MET assessed as inhibition of autophosphorylation by continuous fluorometric assayMore data for this Ligand-Target Pair
Affinity DataKi: 49nMAssay Description:Binding affinity to human recombinant c-MET assessed as inhibition of autophosphorylation by continuous fluorometric assayMore data for this Ligand-Target Pair
Affinity DataKi: 50nMAssay Description:Inhibition of human activated c-Met by PK/LDH coupled kinetic assayMore data for this Ligand-Target Pair
Affinity DataKi: 60nMAssay Description:Binding affinity to human recombinant c-MET assessed as inhibition of autophosphorylation by continuous fluorometric assayMore data for this Ligand-Target Pair
Affinity DataKi: 68nMAssay Description:Binding affinity to human recombinant c-MET assessed as inhibition of autophosphorylation by continuous fluorometric assayMore data for this Ligand-Target Pair
Affinity DataKi: 70nMAssay Description:Binding affinity to human recombinant c-MET assessed as inhibition of autophosphorylation by continuous fluorometric assayMore data for this Ligand-Target Pair
Affinity DataKi: 75nMAssay Description:Binding affinity to human recombinant c-MET assessed as inhibition of autophosphorylation by continuous fluorometric assayMore data for this Ligand-Target Pair
Affinity DataKi: 80nMAssay Description:Inhibition of human activated c-Met by PK/LDH coupled kinetic assayMore data for this Ligand-Target Pair
Affinity DataKi: 82nMAssay Description:Binding affinity to human recombinant c-MET assessed as inhibition of autophosphorylation by continuous fluorometric assayMore data for this Ligand-Target Pair
Affinity DataKi: 100nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
Affinity DataKi: 100nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Mus musculus (Mouse))
Pfizer
Curated by ChEMBL
Pfizer
Curated by ChEMBL
Affinity DataKi: 130nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Mus musculus (Mouse))
Pfizer
Curated by ChEMBL
Pfizer
Curated by ChEMBL
Affinity DataKi: 130nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
Affinity DataKi: 146nM ΔG°: -38.6kJ/molepH: 7.4 T: 2°CAssay Description:The inhibitors reported in this study bind to CHK1 according to a general mechanism illustrated in Scheme 1 where E, S, and I stand for enzyme, subst...More data for this Ligand-Target Pair
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Mus musculus (Mouse))
Pfizer
Curated by ChEMBL
Pfizer
Curated by ChEMBL
Affinity DataKi: 150nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
Affinity DataKi: 161nMAssay Description:Binding affinity to human recombinant c-MET assessed as inhibition of autophosphorylation by continuous fluorometric assayMore data for this Ligand-Target Pair
Affinity DataKi: 170nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
Affinity DataKi: 201nMAssay Description:Binding affinity to human recombinant c-MET assessed as inhibition of autophosphorylation by continuous fluorometric assayMore data for this Ligand-Target Pair
Affinity DataKi: 210nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
Affinity DataKi: 230nMAssay Description:Binding affinity to human recombinant c-MET assessed as inhibition of autophosphorylation by continuous fluorometric assayMore data for this Ligand-Target Pair
Affinity DataKi: 230nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
