Compile Data Set for Download or QSAR
maximum 50k data
Found 2459 Enz. Inhib. hit(s) with Target = '3-phosphoinositide-dependent protein kinase 1'
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361648(CHEMBL1940246)
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361649(CHEMBL1938415)
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361642(CHEMBL1940251)
Affinity DataKi:  0.700nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361641(CHEMBL1940247)
Affinity DataKi:  0.900nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361652(CHEMBL1940250)
Affinity DataKi:  1nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361650(CHEMBL1940248)
Affinity DataKi:  1.30nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361644(CHEMBL1940253)
Affinity DataKi:  1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361643(CHEMBL1940252)
Affinity DataKi:  1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361653(CHEMBL1940245)
Affinity DataKi:  2nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361651(CHEMBL1940249)
Affinity DataKi:  2.5nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361647(CHEMBL1940244)
Affinity DataKi:  35nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50402020(CHEMBL2205426)
Affinity DataKi:  71nMAssay Description:Inhibition of recombinant PDK1 after 1 hr by scintillation counter analysis in presence of gamma-[33P]ATPMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361646(CHEMBL1940243)
Affinity DataKi:  100nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50341250(CHEMBL1765751 | N-{(3R,5R)-1-[2-Amino-6-(3-amino-1...)
Affinity DataIC50:  0.631nMAssay Description:Inhibition of PDK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50341249(1,1-Dimethylethyl{(3R,5R)-1-[2-Amino-6-(3-amino-1H...)
Affinity DataIC50:  0.794nMAssay Description:Inhibition of PDK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM105283(US8575203, I-50)
Affinity DataIC50:  1nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM105303(US8575203, I-70)
Affinity DataIC50:  1nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM105308(US8575203, I-75)
Affinity DataIC50:  1nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM139765(US8895581, I-1)
Affinity DataIC50:  1nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM139785(US8895581, II-6)
Affinity DataIC50:  1nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM139796(US8895581, II-17)
Affinity DataIC50:  1nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM139798(US8895581, II-19)
Affinity DataIC50:  1nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM139819(US8895581, III-5)
Affinity DataIC50:  1nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM139828(US8895581, III-14)
Affinity DataIC50:  1nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM139837(US8895581, III-23)
Affinity DataIC50:  1nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM139840(US8895581, III-26)
Affinity DataIC50:  1nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM139845(US8895581, III-31)
Affinity DataIC50:  1nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50341241((3S,6R)-1-[6-(3-Amino-1H-indazol-6-yl)-2-(methylam...)
Affinity DataIC50:  1.60nMAssay Description:Inhibition of PDK1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM105273(US8575203, I-40)
Affinity DataIC50:  2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM105284(US8575203, I-51)
Affinity DataIC50:  2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM139816(US8895581, III-2)
Affinity DataIC50:  2nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM139809(US8895581, II-30)
Affinity DataIC50:  2nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM139800(US8895581, II-21)
Affinity DataIC50:  2nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM105294(US8575203, I-61)
Affinity DataIC50:  2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM105295(US8575203, I-62)
Affinity DataIC50:  2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM105356(US8575203, I-123)
Affinity DataIC50:  2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM105357(US8575203, I-124)
Affinity DataIC50:  2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM105358(US8575203, I-125)
Affinity DataIC50:  2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM105367(US8575203, I-125.9)
Affinity DataIC50:  2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM105375(US8575203, I-125.17)
Affinity DataIC50:  2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM105263(US8575203, I-30)
Affinity DataIC50:  2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM105376(US8575203, I-125.18)
Affinity DataIC50:  2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM105379(US8575203, I-125.21)
Affinity DataIC50:  2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM105305(US8575203, I-72)
Affinity DataIC50:  2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM105309(US8575203, I-76)
Affinity DataIC50:  2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM139768(US8895581, I-4)
Affinity DataIC50:  2nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM139774(US8895581, I-10)
Affinity DataIC50:  2nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM139780(US8895581, II-1)
Affinity DataIC50:  2nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM139782(US8895581, II-3)
Affinity DataIC50:  2nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In DepthDetails US Patent
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM139788(US8895581, II-9)
Affinity DataIC50:  2nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In DepthDetails US Patent
Displayed 1 to 50 (of 2459 total ) | Next | Last >>
Jump to: