BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Streptavadin(N23A)
Syringe Reactant:BDBM12
Meas. Tech.:ITC
Entry Date:12/19/00
 
Δ G ° :n/a
pH:7±n/a
Log10Kb:n/a
Temperature:310.15±n/a (K)
ΔH° :-21.5± (kcal/mole)
ΔHobs :-21.5± (kcal/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° :n/a
Comments:n/a
 
Citation Klumb, LAChu, VStayton, PS Energetic roles of hydrogen bonds at the ureido oxygen binding pocket in the streptavidin-biotin complex. Biochemistry37:7657-63 (1998) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Instrument Info
 
Streptavadin(N23A)
Source:Protein was expressed in a T7 expression system (pET-21a, Novagen Inc.,Madison,WI) as insoluble inclusion bodies.
Purity:n/a
Prep. Method:Refolded protein was purified by affinity chromatography with iminobiotin-agarose.
Name:Streptavadin(N23A)
Synonyms:streptavadin (N23A)
Type:Protein
Mol. Mass.:16447.70
Organism:Streptomyces avidinii
Description:Biotin-Binding Protein
Residue:159
Sequence:
DPSKDSKAQVSAAEAGITGTWYAQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRY
DSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAW
KSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM12
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM12
Synonyms:5-[(3aS,4S,6aR)-2-oxo-hexahydro-1H-thieno[3,4-d]imidazolidin-4-yl]pentanoic acid | Biotin | cid_171548 | cid_253
TypeEnzyme co-factor
Emp. Form.C10H16N2O3S
Mol. Mass.244.311
SMILES[H][C@]12CS[C@@H](CCCCC(O)=O)[C@@]1([H])NC(=O)N2 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.