BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:BirA Bifunctional Protein
Syringe Reactant:BDBM12
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:12/09/07
 
ΔG°:-9.84±0.0400 (kcal/mole)
pH:7.5±0.02
Log10Kb:7.37± 6.23
Temperature:293.15±0.1 (K)
ΔH° :n/a
ΔHobs :-19.4±0.200 (kcal/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:no
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:0.91
ΔS° :-0.0300±0 (kcal/mole-K)
Comments:n/a
 
Citation Naganathan, SBeckett, D Nucleation of an allosteric response via ligand-induced loop folding. J Mol Biol373:96-111 (2007) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
BirA Bifunctional Protein
Source:The BirA variants were expressed in the Escherichia coli strain JM109 transformed with the plasmid pBtac2 carrying the E. coli birA gene (wild-type or mutant) under transcriptional control of the tac.
Purity:>95%
Prep. Method:The separation and purification of BirA from other cellular proteins was carried out in NiNTA column and Sepharose chromatography steps.
Name:BirA Bifunctional Protein
Synonyms:Biotin operon repressor | Biotin protein ligase (BPL) | Biotin--[acetyl-CoA-carboxylase] synthetase
Type:Repressor protein
Mol. Mass.:35313.58
Organism:Escherichia coli
Description:n/a
Residue:321
Sequence:
MKDNTVPLKLIALLANGEFHSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGKGYSL
PEPIQLLNAKQILGQLDGGSVAVLPVIDSTNQYLLDRIGELKSGDACIAEYQQAGRGRRG
RKWFSPFGANLYLSMFWRLEQGPAAAIGLSLVIGIVMAEVLRKLGADKVRVKWPNDLYLQ
DRKLAGILVELTGKTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAA
MLIRELRAALELFEQEGLAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLL
EQDGIIKPWMGGEISLRSAEK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM12
Source:Sigma-Aldrich
Purity:n/a
Prep. Method:n/a
NameBDBM12
Synonyms:5-[(3aS,4S,6aR)-2-oxo-hexahydro-1H-thieno[3,4-d]imidazolidin-4-yl]pentanoic acid | Biotin | cid_171548 | cid_253
TypeEnzyme co-factor
Emp. Form.C10H16N2O3S
Mol. Mass.244.311
SMILES[H][C@]12CS[C@@H](CCCCC(O)=O)[C@@]1([H])NC(=O)N2 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.