BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Streptavidin
Syringe Reactant:BDBM12
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:04/30/08
 
Δ G ° :n/a
pH:n/a
Log10Kb:n/a
Temperature:298.15±n/a (K)
ΔH° :n/a
ΔHobs :-24.5± (kcal/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:no
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:0.97
ΔS° :n/a
Comments:n/a
 
Citation Chilkoti, ABoyer, FEStayton, PSVara Prasad, JVDomagala, JMEllsworth, ELGajda, CHagen, SEMarkoski, LJTait, BDLunney, EAPalovsky, AFerguson, DGraham, NHoller, THupe, DNouhan, CTummino, PJUrumov, AZeikus, EZeikus, GGracheck, SJSanders, JMVanderRoest, SBrodfuehrer, JIyer, KSinz, MGulnik, SV Molecular Origins of the Slow Streptavidin-Biotin Dissociation Kinetics J Am Chem Soc117:10622-10628 (1995)    Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
Streptavidin
Source:Protein was expressed in a T7 expression system (pET-21a, Novagen Inc.,Madison,WI) as insoluble inclusion bodies.
Purity:n/a
Prep. Method:Refolded protein was purified by affinity chromatography with iminobiotin-agarose.
Name:Streptavidin
Synonyms:n/a
Type:Protein
Mol. Mass.:18835.54
Organism:Streptomyces avidinii
Description:P22629
Residue:183
Sequence:
MRKIVVAAIAVSLTTVSITASASADPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGAD
GALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQY
VGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDA
VQQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM12
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM12
Synonyms:5-[(3aS,4S,6aR)-2-oxo-hexahydro-1H-thieno[3,4-d]imidazolidin-4-yl]pentanoic acid | Biotin | cid_171548 | cid_253
TypeEnzyme co-factor
Emp. Form.C10H16N2O3S
Mol. Mass.244.311
SMILES[H][C@]12CS[C@@H](CCCCC(O)=O)[C@@]1([H])NC(=O)N2 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.