Cell Reactant:
sc1E3
Syringe Reactant:
hIL-1beta
Meas. Tech.:
ITC
Entry Date.:
12/05/00
ΔG°:
-46.2±0.42 (kJ/mole)
pH:
7±n/a
Log10Kb:
7.1
Temperature:
298.15±n/a (K)
ΔH° :
-64.68±0.42 (kJ/mole)
ΔHobs :
-57.96±n/a (kJ/mole)
Corrected for ΔHioniz:
yes
Protons Released:
0.15
ΔCp :
-1.19±0.349 (kJ/mole)
ΔS° :
-0.06±0.001 (kJ/mole-K)
Citation
 Chrunyk, BARosner, MHCong, YMcColl, ASOtterness, IGDaumy, GO Inhibiting protein-protein interactions: a model for antagonist design Biochemistry 39:7092-7099 (2000)  
Cell React
Source:
Protein was expressed in E.coli consisted of the C-terminal end of the VL of the mAb1E3 joined to the N-terminal end of the VH by a linker.
Prep. Method:
Cell suspension was purified by bound to anti-Flag M2 affinity column, and then a HiLoad Superdex 75 16/60 column
Name:
sc1E3
Synonyms:
n/a
Type:
Single Chain Antibody
Mol. Mass.:
358.43
Organism:
Escherichia coli
Description:
single chain antibody that blocked binding between IL-1beta and IL-1 receptor
Residue:
3
Sequence:
NA
  
Syringe React
Name:
Interleukin-1 beta
Synonyms:
Interleukin 1-beta | Interleukin-1 beta | hIL-1beta
Type:
Cytokine
Mol. Mass.:
30734.47
Organism:
Homo sapiens (Human)
Description:
P01584
Residue:
269
Sequence:
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS