Cell Reactant:
Ephrin type-A receptor 4 ligand binding domain (D61G/E62G-EphA4-LBD)
Syringe Reactant:
BDBM223311
Meas. Tech.:
Enzyme Inhibition
Entry Date.:
04/27/17
ΔG°:
-36.7±n/a (kJ/mole)
pH:
6.5±0
Temperature:
300.15±0 (K)
ΔH° :
-38.2±0.59 (kJ/mole)
ΔS° :
-0.005±0 (kJ/mole-K)
Citation
 Wu, BDe, SKKulinich, ASalem, AFKoeppen, JWang, RBarile, EWang, SZhang, DEthell, IPellecchia, M Potent and Selective EphA4 Agonists for the Treatment of ALS. Cell Chem Biol 24:293-305 (2017) [PubMed]  Article
Cell React
Name:
Ephrin type-A receptor 4 [29-209,D61G,E62G]
Synonyms:
Ephrin type-A receptor 4 ligand binding domain (D61G/E62G-EphA4-LBD)
Type:
Protein
Mol. Mass.:
20722.36
Organism:
Homo sapiens (Human)
Description:
Human EphA4-LBD D61G/E62G double mutant
Residue:
181
Sequence:
NEVTLLDSRSVQGELGWIASPLEGGWEEVSIMGGKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVR
  
Syringe React
Name:
BDBM223311
Synonyms:
123C4
Type:
Small organic molecule
Emp. Form.:
C43H47ClN8O6
Mol. Mass.:
807.336
SMILES:
COc1ccc2[nH]cc(CCNC(=O)[C@H](Cc3ccncc3)NC(=O)[C@H](Cc3ccc(Cl)cc3)NC(=O)[C@H](Cc3c[nH]c4ccc(O)cc34)NC(=O)CCCN)c2c1 |r|
Structure:
Search PDB for entries with ligand similarity: