Cell Reactant:
Thiol:disulfide interchange protein (DsbA)
Syringe Reactant:
BDBM231639
Meas. Tech.:
Enzyme Inhibition
Entry Date.:
06/06/17
ΔG°:
-8.09±n/a (kJ/mole)
pH:
7.4±0
Temperature:
298.15±0 (K)
ΔH° :
-23±0.8 (kJ/mole)
ΔS° :
-0.05±0 (kJ/mole-K)
Comments:
Mixed (oxidized & reduced) AbDsbA
Citation
 Premkumar, LKurth, FDuprez, WGr°ftehauge, MKKing, GJHalili, MAHeras, BMartin, JL Structure of the Acinetobacter baumannii dithiol oxidase DsbA bound to elongation factor EF-Tu reveals a novel protein interaction site. J Biol Chem 289:19869-80 (2014) [PubMed]  Article
Cell React
Name:
Thiol:disulfide interchange protein [27-205]
Synonyms:
Thiol:disulfide interchange protein (DsbA)
Type:
Protein
Mol. Mass.:
20389.27
Organism:
Acinetobacter baumannii (AYE strain)
Description:
A. baumannii DsbA lacking the predicted periplasmic leader sequence (27-205 aa)
Residue:
179
Sequence:
AGKDYTVIANPGKVEVPGKIEVREFFWYGCPHCFKLEPHMQTWLKQIPKDVRFVRTPAAMNKMWEQGARTYYTSEALGVRKRTHLPLFHAIQVNGQQIFDQASAAKFFTRYGVPEQKFNSTYNSFAVTAKVAESNKLAQQYQLTGVPAVVVNGKYVVQGEDGKVTQVLNYLIEKERKAK
  
Syringe React
Name:
BDBM231639
Synonyms:
AFDQIDNAPEE
Type:
Small organic molecule
Emp. Form.:
C53H77N13O22
Mol. Mass.:
1248.2524
SMILES:
CC[C@H](C)[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](C)N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O |r|
Structure:
Search PDB for entries with ligand similarity: