Cell Reactant:
Reverse transcriptase (HIV-1 RT)(1-350)
Syringe Reactant:
BDBM2337
Meas. Tech.:
Enzyme Inhibition
Entry Date.:
06/16/17
ΔG°:
-145±44.8 (kJ/mole)
Temperature:
298.15±0 (K)
ΔH° :
-230±n/a (kJ/mole)
ΔS° :
-0.0678±0.0345 (kJ/mole-K)
Citation
 Decha, PIntharathep, PUdommaneethanakit, TSompornpisut, PHannongbua, SWolschann, PParasuk, V Theoretical studies on the molecular basis of HIV-1RT/NNRTIs interactions. J Enzyme Inhib Med Chem 26:29-36 (2011) [PubMed]  Article
Cell React
Name:
Reverse transcriptase (HIV-1 RT)(aa 1-350)
Synonyms:
n/a
Type:
Enzyme
Mol. Mass.:
39217.95
Organism:
Human immunodeficiency virus type 1
Description:
HIV-1 RT variant (1-350 aa)
Residue:
350
Sequence:
MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAADTGHSNQVSQNYPIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTAC
  
Syringe React
Name:
BDBM2337
Synonyms:
6-benzyl-1-(ethoxymethyl)-5-(propan-2-yl)-1,2,3,4-tetrahydropyrimidine-2,4-dione | CHEMBL35033 | Coactinon | Emivirine | Emivirine (EMV) | HEPT deriv. | I-EBU | MKC-442
Type:
Small organic molecule
Emp. Form.:
C17H22N2O3
Mol. Mass.:
302.3682
SMILES:
CCOCn1c(Cc2ccccc2)c(C(C)C)c(=O)[nH]c1=O
Structure:
Search PDB for entries with ligand similarity: