Cell Reactant:
Reverse transcriptase (HIV-1 RT)(1-350)
Syringe Reactant:
BDBM1434
Meas. Tech.:
Enzyme Inhibition
Entry Date.:
06/16/17
ΔG°:
-126±46 (kJ/mole)
Temperature:
298.15±0 (K)
ΔH° :
-197±n/a (kJ/mole)
ΔS° :
-0.0567±0.0359 (kJ/mole-K)
Citation
 Decha, PIntharathep, PUdommaneethanakit, TSompornpisut, PHannongbua, SWolschann, PParasuk, V Theoretical studies on the molecular basis of HIV-1RT/NNRTIs interactions. J Enzyme Inhib Med Chem 26:29-36 (2011) [PubMed]  Article
Cell React
Name:
Reverse transcriptase (HIV-1 RT)(aa 1-350)
Synonyms:
n/a
Type:
Enzyme
Mol. Mass.:
39217.95
Organism:
Human immunodeficiency virus type 1
Description:
HIV-1 RT variant (1-350 aa)
Residue:
350
Sequence:
MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAADTGHSNQVSQNYPIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTAC
  
Syringe React
Name:
BDBM1434
Synonyms:
11-cyclopropyl-5,11-dihydro-4-methyl-6H-dipyrido[3,2-b:2 ,3 -e][1,4]diazepin-6-one | 2-cyclopropyl-7-methyl-2,4,9,15-tetraazatricyclo[9.4.0.0^{3,8}]pentadeca-1(11),3,5,7,12,14-hexaen-10-one | BI-RG-587 | CHEMBL57 | Nevirapine | Nevirapine (NVP) | Viramune
Type:
Small organic molecule
Emp. Form.:
C15H14N4O
Mol. Mass.:
266.2979
SMILES:
Cc1ccnc2N(C3CC3)c3ncccc3C(=O)Nc12
Structure:
Search PDB for entries with ligand similarity: