Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetToll-like receptor 8
LigandBDBM507049
Substrate/Competitorn/a
Meas. Tech.Pharmacological Test
EC50 3.00±n/a nM
Citation Dey, FWang, LYun, HZhang, WZhang, ZZhu, W Dihydropyrimidinyl benzazepine carboxamide compounds US Patent US11046671 Publication Date 6/29/2021
More Info.:Get all data from this article,  Assay Method
 
Toll-like receptor 8
Name:Toll-like receptor 8
Synonyms:CD_antigen: CD288 | TRL8
Type:Enzyme
Mol. Mass.:119828.77
Organism:Homo sapiens (Human)
Description:Q9NR97
Residue:1041
Sequence:
MENMFLQSSMLTCIFLLISGSCELCAEENFSRSYPCDEKKQNDSVIAECSNRRLQEVPQT
VGKYVTELDLSDNFITHITNESFQGLQNLTKINLNHNPNVQHQNGNPGIQSNGLNITDGA
FLNLKNLRELLLEDNQLPQIPSGLPESLTELSLIQNNIYNITKEGISRLINLKNLYLAWN
CYFNKVCEKTNIEDGVFETLTNLELLSLSFNSLSHVPPKLPSSLRKLFLSNTQIKYISEE
DFKGLINLTLLDLSGNCPRCFNAPFPCVPCDGGASINIDRFAFQNLTQLRYLNLSSTSLR
KINAAWFKNMPHLKVLDLEFNYLVGEIASGAFLTMLPRLEILDLSFNYIKGSYPQHINIS
RNFSKLLSLRALHLRGYVFQELREDDFQPLMQLPNLSTINLGINFIKQIDFKLFQNFSNL
EIIYLSENRISPLVKDTRQSYANSSSFQRHIRKRRSTDFEFDPHSNFYHFTRPLIKPQCA
AYGKALDLSLNSIFFIGPNQFENLPDIACLNLSANSNAQVLSGTEFSAIPHVKYLDLTNN
RLDFDNASALTELSDLEVLDLSYNSHYFRIAGVTHHLEFIQNFTNLKVLNLSHNNIYTLT
DKYNLESKSLVELVFSGNRLDILWNDDDNRYISIFKGLKNLTRLDLSLNRLKHIPNEAFL
NLPASLTELHINDNMLKFFNWTLLQQFPRLELLDLRGNKLLFLTDSLSDFTSSLRTLLLS
HNRISHLPSGFLSEVSSLKHLDLSSNLLKTINKSALETKTTTKLSMLELHGNPFECTCDI
GDFRRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSLELTTCVSDVTAVILFFFTFFITT
MVMLAALAHHLFYWDVWFIYNVCLAKVKGYRSLSTSQTFYDAYISYDTKDASVTDWVINE
LRYHLEESRDKNVLLCLEERDWDPGLAIIDNLMQSINQSKKTVFVLTKKYAKSWNFKTAF
YLALQRLMDENMDVIIFILLEPVLQHSQYLRLRQRICKSSILQWPDNPKAEGLFWQTLRN
VVLTENDSRYNNMYVDSIKQY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM507049
NameBDBM507049
Synonyms:2-Amino-8-(5-fluoro-1,4-dihydroquinazolin-2-yl)-N,N-dipropyl-3H-1-benzazepine-4-carboxamide | US11046671, Example 10
TypeSmall organic molecule
Emp. Form.C25H28FN5O
Mol. Mass.433.5211
SMILESCCCN(CCC)C(=O)C1=Cc2ccc(cc2N=C(N)C1)C1=NCc2c(F)cccc2N1 |t:9,18,23|
Structure
n/a