Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetReplicase polyprotein 1ab
LigandBDBM420298
Substrate/Competitorn/a
Meas. Tech.SARS-CoV-2 Coronavirus 3C Protease FRET Assay
Ki 1.20±0.90 nM
Citation BEZAWADA, PHAWKING, ELHoffman, RLJaini, RKania, RSKulkarni, SLillis, JRLuthra, SLARAMY, MNOwen, DRPencheva, KDPettersson, MYRANE, AMSammons, MFSullivan, BPTHIEL, AJTICEHURST, MDTuttle, JB Compounds and methods for the treatment of covid-19 WIPOWO2021205298 Publication Date 10/14/2021
More Info.:Get all data from this article,  Assay Method
 
Replicase polyprotein 1ab
Name:Replicase polyprotein 1ab
Synonyms:ORF1ab polyprotein | pp1ab
Type:Protein
Mol. Mass.:802616.66
Organism:MHV-A59
Description:P0C6X9
Residue:7176
Sequence:
MAKMGKYGLGFKWAPEFPWMLPNASEKLGNPERSEEDGFCPSAAQEPKVKGKTLVNHVRV
NCSRLPALECCVQSAIIRDIFVDEDPQKVEASTMMALQFGSAVLVKPSKRLSIQAWTNLG
VLPKTAAMGLFKRVCLCNTRECSCDAHVAFHLFTVQPDGVCLGNGRFIGWFVPVTAIPEY
AKQWLQPWSILLRKGGNKGSVTSGHFRRAVTMPVYDFNVEDACEEVHLNPKGKYSCKAYA
LLKGYRGVKPILFVDQYGCDYTGCLAKGLEDYGDLTLSEMKELFPVWRDSLDSEVLVAWH
VDRDPRAAMRLQTLATVRCIDYVGQPTEDVVDGDVVVREPAHLLAANAIVKRLPRLVETM
LYTDSSVTEFCYKTKLCECGFITQFGYVDCCGDTCDFRGWVAGNMMDGFPCPGCTKNYMP
WELEAQSSGVIPEGGVLFTQSTDTVNRESFKLYGHAVVPFGSAVYWSPCPGMWLPVIWSS
VKSYSGLTYTGVVGCKAIVQETDAICRSLYMDYVQHKCGNLEQRAILGLDDVYHRQLLVN
RGDYSLLLENVDLFVKRRAEFACKFATCGDGLVPLLLDGLVPRSYYLIKSGQAFTSMMVN
FSHEVTDMCMDMALLFMHDVKVATKYVKKVTGKLAVRFKALGVAVVRKITEWFDLAVDIA
ASAAGWLCYQLVNGLFAVANGVITFVQEVPELVKNFVDKFKAFFKVLIDSMSVSILSGLT
VVKTASNRVCLAGSKVYEVVQKSLSAYVMPVGCSEATCLVGEIEPAVFEDDVVDVVKAPL
TYQGCCKPPTSFEKICIVDKLYMAKCGDQFYPVVVDNDTVGVLDQCWRFPCAGKKVEFND
KPKVRKIPSTRKIKITFALDATFDSVLSKACSEFEVDKDVTLDELLDVVLDAVESTLSPC
KEHDVIGTKVCALLDRLAGDYVYLFDEGGDEVIAPRMYCSFSAPDDEDCVAADVVDADEN
QDDDAEDSAVLVADTQEEDGVAKGQVEADSEICVAHTGSQEELAEPDAVGSQTPIASAEE
TEVGEASDREGIAEAKATVCADAVDACPDQVEAFEIEKVEDSILDELQTELNAPADKTYE
DVLAFDAVCSEALSAFYAVPSDETHFKVCGFYSPAIERTNCWLRSTLIVMQSLPLEFKDL
EMQKLWLSYKAGYDQCFVDKLVKSVPKSIILPQGGYVADFAYFFLSQCSFKAYANWRCLE
CDMELKLQGLDAMFFYGDVVSHMCKCGNSMTLLSADIPYTLHFGVRDDKFCAFYTPRKVF
RAACAVDVNDCHSMAVVEGKQIDGKVVTKFIGDKFDFMVGYGMTFSMSPFELAQLYGSCI
TPNVCFVKGDVIKVVRLVNAEVIVNPANGRMAHGAGVAGAIAEKAGSAFIKETSDMVKAQ
GVCQVGECYESAGGKLCKKVLNIVGPDARGHGKQCYSLLERAYQHINKCDNVVTTLISAG
IFSVPTDVSLTYLLGVVTKNVILVSNNQDDFDVIEKCQVTSVAGTKALSLQLAKNLCRDV
KFVTNACSSLFSESCFVSSYDVLQEVEALRHDIQLDDDARVFVQANMDCLPTDWRLVNKF
DSVDGVRTIKYFECPGGIFVSSQGKKFGYVQNGSFKEASVSQIRALLANKVDVLCTVDGV
NFRSCCVAEGEVFGKTLGSVFCDGINVTKVRCSAIYKGKVFFQYSDLSEADLVAVKDAFG
FDEPQLLKYYTMLGMCKWPVVVCGNYFAFKQSNNNCYINVACLMLQHLSLKFPKWQWQEA
WNEFRSGKPLRFVSLVLAKGSFKFNEPSDSIDFMRVVLREADLSGATCNLEFVCKCGVKQ
EQRKGVDAVMHFGTLDKGDLVRGYNIACTCGSKLVHCTQFNVPFLICSNTPEGRKLPDDV
VAANIFTGGSVGHYTHVKCKPKYQLYDACNVNKVSEAKGNFTDCLYLKNLKQTFSSVLTT
FYLDDVKCVEYKPDLSQYYCESGKYYTKPIIKAQFRTFEKVDGVYTNFKLVGHSIAEKLN
AKLGFDCNSPFVEYKITEWPTATGDVVLASDDLYVSRYSSGCITFGKPVVWLGHEEASLK
SLTYFNRPSVVCENKFNVLPVDVSEPTDKGPVPAAVLVTGVPGADASAGAGIAKEQKACA
SASVEDQVVTEVRQEPSVSAADVKEVKLNGVKKPVKVEGSVVVNDPTSETKVVKSLSIVD
VYDMFLTGCKYVVWTANELSRLVNSPTVREYVKWGMGKIVTPAKLLLLRDEKQEFVAPKV
VKAKAIACYCAVKWFLLYCFSWIKFNTDNKVIYTTEVASKLTFKLCCLAFKNALQTFNWS
VVSRGFFLVATVFLLWFNFLYANVILSDFYLPNIGPLPTFVGQIVAWFKTTFGVSTICDF
YQVTDLGYRSSFCNGSMVCELCFSGFDMLDNYDAINVVQHVVDRRLSFDYISLFKLVVEL
VIGYSLYTVCFYPLFVLIGMQLLTTWLPEFFMLETMHWSARLFVFVANMLPAFTLLRFYI
VVTAMYKVYCLCRHVMYGCSKPGCLFCYKRNRSVRVKCSTVVGGSLRYYDVMANGGTGFC
TKHQWNCLNCNSWKPGNTFITHEAAADLSKELKRPVNPTDSAYYSVTEVKQVGCSMRLFY
ERDGQRVYDDVNASLFVDMNGLLHSKVKGVPETHVVVVENEADKAGFLGAAVFYAQSLYR
PMLMVEKKLITTANTGLSVSRTMFDLYVDSLLNVLDVDRKSLTSFVNAAHNSLKEGVQLE
QVMDTFIGCARRKCAIDSDVETKSITKSVMSAVNAGVDFTDESCNNLVPTYVKSDTIVAA
DLGVLIQNNAKHVQANVAKAANVACIWSVDAFNQLSADLQHRLRKACSKTGLKIKLTYNK
QEANVPILTTPFSLKGGAVFSRMLQWLFVANLICFIVLWALMPTYAVHKSDMQLPLYASF
KVIDNGVLRDVSVTDACFANKFNQFDQWYESTFGLAYYRNSKACPVVVAVIDQDIGHTLF
NVPTTVLRYGFHVLHFITHAFATDSVQCYTPHMQIPYDNFYASGCVLSSLCTMLAHADGT
PHPYCYTGGVMHNASLYSSLAPHVRYNLASSNGYIRFPEVVSEGIVRVVRTRSMTYCRVG
LCEEAEEGICFNFNRSWVLNNPYYRAMPGTFCGRNAFDLIHQVLGGLVRPIDFFALTASS
VAGAILAIIVVLAFYYLIKLKRAFGDYTSVVVINVIVWCINFLMLFVFQVYPTLSCLYAC
FYFYTTLYFPSEISVVMHLQWLVMYGAIMPLWFCIIYVAVVVSNHALWLFSYCRKIGTEV
RSDGTFEEMALTTFMITKESYCKLKNSVSDVAFNRYLSLYNKYRYFSGKMDTAAYREAAC
SQLAKAMETFNHNNGNDVLYQPPTASVTTSFLQSGIVKMVSPTSKVEPCIVSVTYGNMTL
NGLWLDDKVYCPRHVICSSADMTDPDYPNLLCRVTSSDFCVMSGRMSLTVMSYQMQGCQL
VLTVTLQNPNTPKYSFGVVKPGETFTVLAAYNGRPQGAFHVTLRSSHTIKGSFLCGSCGS
VGYVLTGDSVRFVYMHQLELSTGCHTGTDFSGNFYGPYRDAQVVQLPVQDYTQTVNVVAW
LYAAIFNRCNWFVQSDSCSLEEFNVWAMTNGFSSIKADLVLDALASMTGVTVEQVLAAIK
RLHSGFQGKQILGSCVLEDETPSDVYQQLAGVKLQSKRTRVIKGTCCWILASTFLFCSII
SAFVKWTMFMYVTTHMLGVTLCALCFVSFAMLLIKHKHLYLTMYIMPVLCTFYTNYLVVY
KQSFRGLAYAWLSHFVPAVDYTYMDEVLYGVVLLVAMVFVTMRSINHDVFSIMFLVGRLV
SLVSMWYFGANLEEEVLLFLTSLFGTYTWTTMLSLATAKVIAKWLAVNVLYFTDVPQIKL
VLLSYLCIGYVCCCYWGILSLLNSIFRMPLGVYNYKISVQELRYMNANGLRPPRNSFEAL
MLNFKLLGIGGVPVIEVSQIQSRLTDVKCANVVLLNCLQHLHIASNSKLWQYCSTLHNEI
LATSDLSMAFDKLAQLLVVLFANPAAVDSKCLASIEEVSDDYVRDNTVLQALQSEFVNMA
SFVEYELAKKNLDEAKASGSANQQQIKQLEKACNIAKSAYERDRAVARKLERMADLALTN
MYKEARINDKKSKVVSALQTMLFSMVRKLDNQALNSILDNAVKGCVPLNAIPSLTSNTLT
IIVPDKQVFDQVVDNVYVTYAGNVWHIQFIQDADGAVKQLNEIDVNSTWPLVIAANRHNE
VSTVVLQNNELMPQKLRTQVVNSGSDMNCNTPTQCYYNTTGTGKIVYAILSDCDGLKYTK
IVKEDGNCVVLELDPPCKFSVQDVKGLKIKYLYFVKGCNTLARGWVVGTLSSTVRLQAGT
ATEYASNSAILSLCAFSVDPKKTYLDYIKQGGVPVTNCVKMLCDHAGTGMAITIKPEATT
NQDSYGGASVCIYCRSRVEHPDVDGLCKLRGKFVQVPLGIKDPVSYVLTHDVCQVCGFWR
DGSCSCVGTGSQFQSKDTNFLNRIRGTSVNARLVPCASGLDTDVQLRAFDICNANRAGIG
LYYKVNCCRFQRVDEDGNKLDKFFVVKRTNLEVYNKEKECYELTKECGVVAEHEFFTFDV
EGSRVPHIVRKDLSKFTMLDLCYALRHFDRNDCSTLKEILLTYAECEESYFQKKDWYDFV
ENPDIINVYKKLGPIFNRALLNTAKFADALVEAGLVGVLTLDNQDLYGQWYDFGDFVKTV
PGCGVAVADSYYSYMMPMLTMCHALDSELFVNGTYREFDLVQYDFTDFKLELFTKYFKHW
SMTYHPNTCECEDDRCIIHCANFNILFSMVLPKTCFGPLVRQIFVDGVPFVVSIGYHYKE
LGVVMNMDVDTHRYRLSLKDLLLYAADPALHVASASALLDLRTCCFSVAAITSGVKFQTV
KPGNFNQDFYEFILSKGLLKEGSSVDLKHFFFTQDGNAAITDYNYYKYNLPTMVDIKQLL
FVLEVVNKYFEIYEGGCIPATQVIVNNYDKSAGYPFNKFGKARLYYEALSFEEQDEIYAY
TKRNVLPTLTQMNLKYAISAKNRARTVAGVSILSTMTGRMFHQKCLKSIAATRGVPVVIG
TTKFYGGWDDMLRRLIKDVDSPVLMGWDYPKCDRAMPNILRIVSSLVLARKHDSCCSHTD
RFYRLANECAQVLSEIVMCGGCYYVKPGGTSSGDATTAFANSVFNICQAVSANVCSLMAC
NGHKIEDLSIRELQKRLYSNVYRADHVDPAFVSEYYEFLNKHFSMMILSDDGVVCYNSEF
ASKGYIANISAFQQVLYYQNNVFMSEAKCWVETDIEKGPHEFCSQHTMLVKMDGDEVYLP
YPDPSRILGAGCFVDDLLKTDSVLLIERFVSLAIDAYPLVYHENPEYQNVFRVYLEYIKK
LYNDLGNQILDSYSVILSTCDGQKFTDETFYKNMYLRSAVLQSVGACVVCSSQTSLRCGS
CIRKPLLCCKCAYDHVMSTDHKYVLSVSPYVCNSPGCDVNDVTKLYLGGMSYYCEDHKPQ
YSFKLVMNGMVFGLYKQSCTGSPYIEDFNKIASCKWTEVDDYVLANECTERLKLFAAETQ
KATEEAFKQCYASATIREIVSDRELILSWEIGKVRPPLNKNYVFTGYHFTNNGKTVLGEY
VFDKSELTNGVYYRATTTYKLSVGDVFILTSHAVSSLSAPTLVPQENYTSIRFASVYSVP
ETFQNNVPNYQHIGMKRYCTVQGPPGTGKSHLAIGLAVYYCTARVVYTAASHAAVDALCE
KAHKFLNINDCTRIVPAKVRVDCYDKFKVNDTTRKYVFTTINALPELVTDIIVVDEVSML
TNYELSVINSRVRAKHYVYIGDPAQLPAPRVLLNKGTLEPRYFNSVTKLMCCLGPDIFLG
TCYRCPKEIVDTVSALVYNNKLKAKNDNSSMCFKVYYKGQTTHESSSAVNMQQIHLISKF
LKANPSWSNAVFISPYNSQNYVAKRVLGLQTQTVDSAQGSEYDFVIYSQTAETAHSVNVN
RFNVAITRAKKGILCVMSSMQLFESLNFTTLTLDKINNPRLQCTTNLFKDCSRSYVGYHP
AHAPSFLAVDDKYKVGGDLAVCLNVADSAVTYSRLISLMGFKLDLTLDGYCKLFITRDEA
IKRVRAWVGFDAEGAHAIRDSIGTNFPLQLGFSTGIDFVVEATGMFAERDGYVFKKAAAR
APPGEQFKHLIPLMSRGQKWDVVRIRIVQMLSDHLVDLADSVVLVTWAASFELTCLRYFA
KVGREVVCSVCTKRATCFNSRTGYYGCWRHSYSCDYLYNPLIVDIQQWGYTGSLTSNHDP
ICSVHKGAHVASSDAIMTRCLAVHDCFCKSVNWNLEYPIISNEVSVNTSCRLLQRVMFRA
AMLCNRYDVCYDIGNPKGLACVKGYDFKFYDASPVVKSVKQFVYKYEAHKDQFLDGLCMF
WNCNVDKYPANAVVCRFDTRVLNKLNLPGCNGGSLYVNKHAFHTSPFTRAAFENLKPMPF
FYYSDTPCVYMEGMESKQVDYVPLRSATCITRCNLGGAVCLKHAEEYREYLESYNTATTA
GFTFWVYKTFDFYNLWNTFTRLQSLENVVYNLVNAGHFDGRAGELPCAVIGEKVIAKIQN
EDVVVFKNNTPFPTNVAVELFAKRSIRPHPELKLFRNLNIDVCWSHVLWDYAKDSVFCSS
TYKVCKYTDLQCIESLNVLFDGRDNGALEAFKKCRNGVYINTTKIKSLSMIKGPQRADLN
GVVVEKVGDSDVEFWFAVRKDGDDVIFSRTGSLEPSHYRSPQGNPGGNRVGDLSGNEALA
RGTIFTQSRLLSSFTPRSEMEKDFMDLDDDVFIAKYSLQDYAFEHVVYGSFNQKIIGGLH
LLIGLARRQQKSNLVIQEFVTYDSSIHSYFITDENSGSSKSVCTVIDLLLDDFVDIVKSL
NLKCVSKVVNVNVDFKDFQFMLWCNEEKVMTFYPRLQAAADWKPGYVMPVLYKYLESPLE
RVNLWNYGKPITLPTGCMMNVAKYTQLCQYLSTTTLAVPANMRVLHLGAGSDKGVAPGSA
VLRQWLPAGSILVDNDVNPFVSDSVASYYGNCITLPFDCQWDLIISDMYDPLTKNIGEYN
VSKDGFFTYLCHLIRDKLALGGSVAIKITEFSWNAELYSLMGKFAFWTIFCTNVNASSSE
GFLIGINWLNKTRTEIDGKTMHANYLFWRNSTMWNGGAYSLFDMSKFPLKAAGTAVVSLK
PDQINDLVLSLIEKGKLLVRDTRKEVFVGDSLVNVK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM420298
NameBDBM420298
Synonyms:PF-00835231 | PF-0835231 | WO2005113580-Ex-02 | WO2021205298, Compound 1 | cmdc.202100576, 6b
TypeSmall organic molecule
Emp. Form.C24H32N4O6
Mol. Mass.472.5341
SMILESCOc1cccc2[nH]c(cc12)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C[C@@H]1CCNC1=O)C(=O)CO
Structure
n/a